DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:328 Identity:79/328 - (24%)
Similarity:134/328 - (40%) Gaps:57/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLFLALILFLILTL--YINVSEVDRKPAKRSNQHTLDPLYEEI---------------RILCMIP 57
            |:.|..|...::|:  :|.:...:|. ....:.|...|..|:|               |:.|:|.
Human    11 GVMLGSIFCALITMLGHIRIGHGNRM-HHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIIL 74

  Fly    58 YNYNSPDTAKYVKRTWGKHC---------NVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLMQ 113
            ...........||.||.|||         ||.:|.|.::|           :.|.|.::::....
Human    75 VKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMD-----------TNDMWLMMRKAYKY 128

  Fly   114 AYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVI 178
            |:..|.||.:||....|::|.::|||:|.:.|:  .||||.|.|:.:::  ....:|....|.|:
Human   129 AFDKYRDQYNWFFLARPTTFAIIENLKYFLLKK--DPSQPFYLGHTIKS--GDLEYVGMEGGIVL 189

  Fly   179 SREALRRYTMASKDPENKECTHWEGYV----EGLDIHRCLRFANVTVAESRDEFEHETFLPVTMD 239
            |.|:::|.......||  :|....|.:    |...:..||::|.|....:.|....:.|...::.
Human   190 SVESMKRLNSLLNIPE--KCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVG 252

  Fly   240 YQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLKIFGTPVRNSID 304
            ......         ::||.........|..|:.|....|.:|:...|.||||:.||....:::.
Human   253 LSIKEA---------MTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALV 308

  Fly   305 FRP 307
            |.|
Human   309 FLP 311



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.