DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and F56H6.1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_493101.1 Gene:F56H6.1 / 186412 WormBaseID:WBGene00010162 Length:327 Species:Caenorhabditis elegans


Alignment Length:203 Identity:41/203 - (20%)
Similarity:85/203 - (41%) Gaps:35/203 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RILCMI---PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQGLM 112
            ::.|.:   ..:|:  |....:..||...|:         :|......|:.||..|::.|...|.
 Worm    79 QLFCFVETSAVHYD--DRVPSIASTWLPKCD---------NGRFFTKTPLPNSNMTYSTVYLNLK 132

  Fly   113 QAYL---------FY------ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELEN 162
            .:|.         ||      :...||:|:.:..::..:::|:..:  ....|::|:|.||.|:.
 Worm   133 DSYYDLFRKTTFGFYYSYMHISKSFDWYLKADDDTYFAMDHLKEYL--STLDPTKPLYLGYVLKP 195

  Fly   163 IVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDE 227
            ...: .:....|||::|..|::.:.   :...:.|.|....:.|...:.||:..|.:...::||:
 Worm   196 YFKN-GYNSGGSGYILSNAAVKLFV---EKLYHDEYTCPYDWAEDRGMGRCMARAGIFPTDTRDD 256

  Fly   228 FEHETFLP 235
            .....|:|
 Worm   257 KGLNRFMP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
F56H6.1NP_493101.1 Galactosyl_T <127..254 CDD:304462 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29075
OrthoDB 1 1.010 - - D555141at33208
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.