DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and E03H4.3

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_493146.2 Gene:E03H4.3 / 184018 WormBaseID:WBGene00008471 Length:322 Species:Caenorhabditis elegans


Alignment Length:271 Identity:48/271 - (17%)
Similarity:109/271 - (40%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RILCMIPYN---YNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDTWTLVQQ--- 109
            :|.|.:..:   ||  |....:..||.:.|:         :|......|:.::..|::.|.:   
 Worm    79 QIFCFVETSERYYN--DRVPSIAATWLRRCD---------NGRFFSKTPLPSANMTYSTVYKNLE 132

  Fly   110 ------------GLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELEN 162
                        |...:|:..::..||:|:.:..::..:::||..::  ...||:|:|.||.:::
 Worm   133 DSFFDLFRKSIFGFYYSYMHISNSFDWYLKADDDTYFAMDHLREYLN--TLDPSKPLYLGYVIKS 195

  Fly   163 IVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWE-----GYVEGLDIHRCLRFANVTVA 222
            .:.: .:....:||::|..|::.:.        ::..|.|     .:.|...:.|||....:...
 Worm   196 GLKN-GYNSGGAGYILSNAAVKIFV--------EKLYHDEYGCPYDWAEDRGMGRCLARVGIYPT 251

  Fly   223 ESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYP-------- 279
            ::||:.....|:|.....|...........:.:|.|:..:.|:.:....:     :|        
 Worm   252 DTRDDKGFNRFMPYRPSEQAAVEAGQFSSQKFVSLHRFPQDTMLLLDELL-----HPELRKNDTN 311

  Fly   280 PEMYDYYYFVY 290
            |.:.:|.:|.|
 Worm   312 PVVVNYDFFRY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
E03H4.3NP_493146.2 Galactosyl_T <130..252 CDD:304462 23/132 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.