DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C17A2.3

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:281 Identity:67/281 - (23%)
Similarity:110/281 - (39%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RILCMIPYNYNSPDTAKYVK-------RTWGKHC-NVLLFVSGDIDGELEPYVPVINST------ 101
            :|.|.:      ..:.||.|       .||...| :...|....:     ||..:..||      
 Worm   101 QIFCFV------ETSTKYYKDRVPSVASTWLPRCDHGRFFTKTHL-----PYPDIAYSTVYRNLR 154

  Fly   102 DTW-TLVQQGLMQAYLFY---ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELEN 162
            ||: .|.::.:...|..|   :...||:|:.:..:||.:::||..::  ...|::|:|.||.|..
 Worm   155 DTYDDLFRKSIFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLN--TLNPAEPLYLGYRLAP 217

  Fly   163 IVTHESFVHHHSGYVISREALRRYTMASKDPEN-----KECTHWEGYVEGLDIHRCLRFANVTVA 222
            .: :..:....|||::|..|:|.:.      |.     :.|.:..|...|:.  |||....:|.:
 Worm   218 FM-NNGYNSGGSGYILSNAAMRMFV------EQLYHNVRLCPYDRGEDRGMG--RCLESVGITPS 273

  Fly   223 ESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEM---YD 284
            ::||:.|...|:|...        ..||.:.. .:|....| .|..|:....|...||||   .|
 Worm   274 DTRDDQELNRFMPFRP--------AEIPIIGS-KWHYFPLK-YPFISKKFVTLHRVPPEMMISLD 328

  Fly   285 YYYFVYRLKIFGTPVRNSIDF 305
            ...:...    |.|..|..||
 Worm   329 KSLYSEN----GEPTFNVTDF 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 36/151 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.