DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C16D9.6

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 / 182687 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans


Alignment Length:290 Identity:72/290 - (24%)
Similarity:114/290 - (39%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFLALILFLILTLYINVSEVDRKPAKRSNQHTLDPLYE----------EIRILCMIPYNYNSPDT 65
            |.||.||..|..|..|.|  .|....|.|...|..|.|          :.::.|.:..:....||
 Worm    49 LILAAILITIFLLTRNNS--PRATYDRKNDSKLLDLIEVSPAAQRLPKKGKLFCWVQTSTIYHDT 111

  Fly    66 AKY-VKRTWGKHC-NVLLFVSGDIDGELEPYVPVINS--TDTWTLVQQGLMQAYLFY------AD 120
            ... :..||...| :..||.|...:....||..|...  .|.:.|.   ....|.|:      :.
 Worm   112 RSLAINETWIHRCDHGQLFTSERFNDTRIPYSTVFKGIPDDYYNLF---FKSRYAFHHIYTNISS 173

  Fly   121 QIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALR- 184
            :.||:|:.:..:||::||||..:  ....|.:|.|.||.|:..:.: .:....:||::||.||: 
 Worm   174 EFDWYLKADDDTFVIVENLRSFL--STLNPDEPHYLGYVLKPYLKN-GYNAGGAGYILSRAALKI 235

  Fly   185 ----RYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEF---EHETFLPVTMDYQF 242
                .|:.|:..|::        ..|.:.|.|||..|.:...::|:..   ...||.|....:|.
 Worm   236 FSEQLYSNATLCPDD--------IYEDVGIARCLANAGMYPEDTRNSLGQNRFNTFSPSDTFHQT 292

  Fly   243 LNGYDTIPWLR-------------KLSYHK 259
            ..|.|   |::             .:|:||
 Worm   293 KAGID---WVKFKENKGYEAFANDLISFHK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:304462 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.