DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and C02H6.1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_504891.1 Gene:C02H6.1 / 182129 WormBaseID:WBGene00015361 Length:334 Species:Caenorhabditis elegans


Alignment Length:315 Identity:66/315 - (20%)
Similarity:126/315 - (40%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PRRVYYGLFLALILFLILTLYINVSEVDRKPAKRSNQHTLDPLYEEIRILCMIP-----YNYNSP 63
            |.|.||            :|..||:::.:  ....::.|.| |....::.|.:.     :|...|
 Worm    54 PYREYY------------SLTRNVNKLTQ--GIEDSEATYD-LPTSGQLFCFVETSKKYFNDRVP 103

  Fly    64 DTAKYVKRTWGKHC-NVLLFVSGDIDGELEPYVPVINSTDT--WTLVQQGLMQ---AYLFYADQI 122
            ..|.    ||...| |...|:...:..|..|:..|..:.:.  :.|.::.|:.   :|.:.:...
 Worm   104 SMAS----TWLPRCDNGRFFLKTPLVDEKIPFSTVYRNLEDSYYDLFRKTLLSFYYSYTYISKDF 164

  Fly   123 DWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREALRRYT 187
            ||:|:.:..::.::::|:..:.  ....|:|::.||.::..: ...:....:||::|..|:|.:.
 Worm   165 DWYLKADDDNYFMIDHLKEYLD--TLDASKPLFLGYRMKPFL-EGGYNSGGAGYLLSNAAVRIFV 226

  Fly   188 MASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFLPVTMD-----------YQ 241
            ......| |.|.:  .:.|...|.|||....:..:::||......|||....           |.
 Worm   227 EHLYHDE-KRCPY--DWAEDRGIARCLASMGILPSDTRDNDGSCRFLPFRPSEMPGIPEAYHYYP 288

  Fly   242 FLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFL--VEYP--------PEMYDYY 286
            ..||  :....:.:|.|:       ||.|.:.||  :.||        ||.:|.:
 Worm   289 LKNG--SFVSEKFISLHR-------ISPRKMIFLDSILYPSSERRLFTPEFFDIF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
C02H6.1NP_504891.1 Galactosyl_T 83..>223 CDD:304462 27/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.