DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and B3GLCT

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_919299.3 Gene:B3GLCT / 145173 HGNCID:20207 Length:498 Species:Homo sapiens


Alignment Length:254 Identity:52/254 - (20%)
Similarity:109/254 - (42%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FLILTLYINVSEVDRKPAKRSNQHTLDPLYEEIRILCMIPYNYNSPDTAKYVKRTWGKHCNVLLF 82
            |...|.:.:...:.|||.|:          ::|.:.......::. |....||:||....:::.:
Human   247 FYCATTFHSFLPLCRKPVKK----------KDIFVAVKTCKKFHG-DRIPIVKQTWESQASLIEY 300

  Fly    83 VSGDIDGELEPYVPV-INSTD------TWTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLR 140
            .|...:..: |.|.: |.:||      |:.::::.|.::    .|:..|.:.|:..:.:.:..|:
Human   301 YSDYTENSI-PTVDLGIPNTDRGHCGKTFAILERFLNRS----QDKTAWLVIVDDDTLISISRLQ 360

  Fly   141 YMIHKRKYQPSQPIY----FGYELENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHW 201
            :::  ..|...:|::    :||.|.  ....|::....|.|.||||:|| .:|||      |..:
Human   361 HLL--SCYDSGEPVFLGERYGYGLG--TGGYSYITGGGGMVFSREAVRR-LLASK------CRCY 414

  Fly   202 EGYV-EGLDIHRCLRFANVTVAESRDEFEHETFLPVTMDYQFLNGYDTIPWLRKLSYHK 259
            .... :.:.:..|  |:.:.:..:.....|:. .||.....:|:  ..:|    :|:||
Human   415 SNDAPDDMVLGMC--FSGLGIPVTHSPLFHQA-RPVDYPKDYLS--HQVP----ISFHK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
B3GLCTNP_919299.3 Galactosyl_T 264..467 CDD:304462 47/237 (20%)
Prevents secretion from ER 495..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.