DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and c1galt1

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_002938761.1 Gene:c1galt1 / 100487794 XenbaseID:XB-GENE-992000 Length:362 Species:Xenopus tropicalis


Alignment Length:278 Identity:83/278 - (29%)
Similarity:141/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HTLDPLYEEIRILCMI---PYNYNSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTD 102
            |..|.||.:::|||.:   |.|.:.  ..|:||.||.:.||.:|::|.:.:.|.    |.: ..|
 Frog    82 HVADDLYSKVKILCWVMTGPQNLDK--KTKHVKATWAQRCNKVLYMSSEENKEF----PTV-GLD 139

  Fly   103 T--------WTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYE 159
            |        |..: :.....:..:.::.|||::.:..::|||:|||:::  .|:.|:.|:|||..
 Frog   140 TKEGRDQLYWKTI-KAFQYVHDHHLEEADWFMKADDDTYVVLDNLRWLL--SKHDPNDPVYFGRR 201

  Fly   160 LENIVTHESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAES 224
            .:..| .:.::...:|||:|:|||:|:..|.|:   ::||| ...||.|.:.:|:...||...:|
 Frog   202 FKPYV-KQGYMSGGAGYVLSKEALKRFVNAFKE---EKCTH-SSSVEDLALGKCMENINVKAGDS 261

  Fly   225 RDEFEHETFLPVTMDYQFLNGYDTIP---WLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYY 286
            ||....|||.|...::..::||  :|   |....:|:...|.....|..|:.|.......||...
 Frog   262 RDTSGKETFHPFVPEHHLIHGY--LPKTFWYWNYNYYPAVEGPGCCSDLAVSFHYVDSTTMYQLE 324

  Fly   287 YFVYRLKIFGTPVRNSID 304
            |.|:.|:.:|...|.|.|
 Frog   325 YLVHHLRPYGYKHRYSPD 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
c1galt1XP_002938761.1 Galactosyl_T <168..>254 CDD:389837 32/92 (35%)
EEP 280..>361 CDD:382041 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.