DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and LOC100486174

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_002933748.2 Gene:LOC100486174 / 100486174 -ID:- Length:335 Species:Xenopus tropicalis


Alignment Length:332 Identity:100/332 - (30%)
Similarity:157/332 - (47%) Gaps:65/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VYYGLFLALILFLILTLYINVSEV-----DRKPAKRSNQHTL---------DPLYEEIRILCMIP 57
            :|:.|.|.:..|:.|.:|.:|.|:     ...|::..|.|.:         :.|..::|:||.| 
 Frog    15 LYFCLGLLVGFFMTLNMYNSVQELTISFNPPDPSQWDNNHFIHLSDNSNVSELLARKVRVLCWI- 78

  Fly    58 YNYNSPDTAK----YVKRTWGKHCNVLLFVS------------GDIDGELEPYVPVINSTDTWTL 106
              ..||...|    ::||:|.:|||:.||:|            |..:|..|.|         |..
 Frog    79 --MTSPKNLKKKAIHLKRSWARHCNITLFMSSTANEIFPTIGLGTKEGREELY---------WKT 132

  Fly   107 VQ--QGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESF 169
            ::  |.:.|.||   ||.||||:.:..::||:|||::::  ..|.|.||||.|...:..|| :.:
 Frog   133 IRAFQYIHQNYL---DQADWFLKADDDTYVVMENLQFLL--SNYTPEQPIYLGKRFKPFVT-QGY 191

  Fly   170 VHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEHETFL 234
            :...:|||:|:|:|:|:..|.:   ...|||... :|.|.:.:|:....|...:|||..:.|||.
 Frog   192 MSGGAGYVLSKESLKRFVEAFR---TGVCTHTSS-IEDLALGQCMEKLGVIPGDSRDSEKRETFH 252

  Fly   235 P------VTMDYQFLNGYDTIPWLRKLSYHKRTEKTVPISSRAICFLVEYPPEMYDYYYFVYRLK 293
            |      :|.||  :|.:|.. |  ...|:...:.....|..||.|....|..||...||||.|:
 Frog   253 PFTPETHITSDY--INDFDDY-W--TYCYYPIIQGPQCCSDLAISFHYVSPELMYMLEYFVYYLR 312

  Fly   294 IFGTPVR 300
            .:|...|
 Frog   313 AYGYQYR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
LOC100486174XP_002933748.2 Galactosyl_T 92..>237 CDD:304462 52/163 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.