DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34451 and LOC100486030

DIOPT Version :9

Sequence 1:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_002933747.2 Gene:LOC100486030 / 100486030 -ID:- Length:276 Species:Xenopus tropicalis


Alignment Length:268 Identity:79/268 - (29%)
Similarity:115/268 - (42%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NSPDTAKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVI-----NSTDT--WTLVQQGLMQAYLFY 118
            |....|.:||.||.:||||.||:|...|.|.    |.|     ...|.  |..: :....|:.:|
 Frog     6 NLQTKAIHVKNTWTRHCNVALFMSSVTDKEF----PTIGLGTGEGRDKLYWKTI-RAFHYAHKYY 65

  Fly   119 ADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVTHESFVHHHSGYVISREAL 183
            .::.||||:.:..::.:::|||:|:  ..|.|.||||||...:... .:.::...:|||:|||||
 Frog    66 LNETDWFLKADDDTYAIVDNLRWML--SNYTPDQPIYFGKRFKPFF-KQGYMSGGAGYVLSREAL 127

  Fly   184 RRYTMASKDPENKECTHWEGYVEGLDIH----------RCLRFANVTVAESRDEFEHETFLPVTM 238
            .|:.              ||:..|:..|          .|::...|...:|||..:.|||.|...
 Frog   128 IRFV--------------EGFRTGICRHITPTEDVAMGNCMQLMGVIAGDSRDTEKRETFNPFAP 178

  Fly   239 DYQFLNGYDTIPWLRKLSYHKRTEKTV----PI-------SSRAICFLVEYPPEMYDYYYFVYRL 292
            :.|.     |:    |.|.||.....|    ||       |..||.:....|..||...||.|..
 Frog   179 ESQL-----TV----KYSEHKENWYWVYCFYPIVEGPQCCSDLAISYHYISPELMYTLEYFTYHF 234

  Fly   293 KIFGTPVR 300
            :.:|...|
 Frog   235 RPYGYQYR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34451NP_001369052.1 None
LOC100486030XP_002933747.2 Galactosyl_T 9..>159 CDD:304462 50/171 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555141at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.