DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:116/260 - (44%) Gaps:52/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IVGGRIVSTVGSSTSKY--PFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRK-- 94
            |||       |.:..|:  |:.|||.|        |:|:|  ||||||||:|:||||||..|:  
Mouse    24 IVG-------GYTCPKHSVPYQVSLND--------GISHQ--CGGSLISDQWVLSAAHCYKRRLQ 71

  Fly    95 ------NIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFRNDIALLYMKRRYWSDFGNGL 153
                  ||..:.....:.:.|.|.:...|..::|:          |||.|:.:|..  :...:.:
Mouse    72 VRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVD----------NDIMLIKLKSP--AILNSQV 124

  Fly   154 QYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEA-EVRVIDNQKCRDIIGHIWAPQNGAN 217
            ....||  ......|..|.:.|:|.|...|.....|.:. |..|:....|:    ..:..|..:|
Mouse   125 STVSLP--RSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCK----KSYPGQITSN 183

  Fly   218 TVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWVQLLM 280
            ..|.  |...:|||.||||||::|  .|:  |.|:||.|..|.:.|.|.:||....|..|:|..|
Mouse   184 MFCLGFLEGGKDSCDGDSGGPVVC--NGE--IQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETM 244

  Fly   281  280
            Mouse   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 79/255 (31%)
Tryp_SPc 34..276 CDD:214473 78/254 (31%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 78/254 (31%)
Tryp_SPc 24..243 CDD:238113 80/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.