DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and Prss44

DIOPT Version :10

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:255 Identity:85/255 - (33%)
Similarity:127/255 - (49%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHY 98
            |||||     .:...|:|:.||||          |..||.|||||||..|:::|||||: .::.|
Mouse   112 IVGGR-----PAPARKWPWQVSLQ----------VHKQHICGGSLISKWWVITAAHCVY-GHLDY 160

  Fly    99 IAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR----NDIALLYMKRRYWSDFGNGLQYAQLP 159
             |.|:|   ..::...:|..:...:.|..|..:..    :||||:.:  .:..::...:|...:|
Mouse   161 -AVFMG---DADLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLL--AFPVNYSVNIQPVCIP 219

  Fly   160 PHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKC----RDIIGHIWA-PQNGANTV 219
            ...........|.:.|:|.....|...:.|.|.|:.:|.::||    :||:|:|:. .|.|.  |
Mouse   220 EKSFLVQPGTLCWVTGWGKVLEQGRSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGG--V 282

  Fly   220 CALGNNQ---DSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWV 276
            |  |.|:   |:|||||||||:|.:.......|:||.||.||..|.|.:||....|.||:
Mouse   283 C--GYNEKGGDACQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 85/255 (33%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 112..340 CDD:238113 84/253 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.