DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and PRSS1

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:281 Identity:77/281 - (27%)
Similarity:116/281 - (41%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LHSLFIISVLESCHAVP------IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCG 75
            ::.|.|::.:.:..|.|      ||||     .....:..|:.|||.           |..||||
Human   226 MNPLLILTFVAAALAAPFDDDDKIVGG-----YNCEENSVPYQVSLN-----------SGYHFCG 274

  Fly    76 GSLISDRWILSAAHCVWRKNI------HYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFRN 134
            ||||:::|::||.|| ::..|      |.|....|.|...|..::       :.:..:......|
Human   275 GSLINEQWVVSAGHC-YKSRIQVRLGEHNIEVLEGNEQFINAAKI-------IRHPQYDRKTLNN 331

  Fly   135 DIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAG---PCQKRLFEAEVRV 196
            ||.|:.:..|  :.....:....||.  ..|.....|.|.|:|.|..:|   |.:.:..:|.  |
Human   332 DIMLIKLSSR--AVINARVSTISLPT--APPATGTKCLISGWGNTASSGADYPDELQCLDAP--V 390

  Fly   197 IDNQKCRDIIGHIWAPQNG---ANTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLT 256
            :...||.       |...|   :|..|.  |...:||||||||||::|    ...:.|:||.|..
Human   391 LSQAKCE-------ASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVC----NGQLQGVVSWGDG 444

  Fly   257 CGIPGMPSIYTVTRPYYDWVQ 277
            |.....|.:||....|..|::
Human   445 CAQKNKPGVYTKVYNYVKWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 73/256 (29%)
Tryp_SPc 34..276 CDD:214473 72/255 (28%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 72/256 (28%)
Tryp_SPc 249..467 CDD:238113 73/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.