DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and LOC560023

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:311 Identity:86/311 - (27%)
Similarity:134/311 - (43%) Gaps:88/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAALDLSPWSWFYWLLHSLFIISVLESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTN 66
            ::|..::...|.:     |.:..::....:..|:||:   .|...:.||  .||||         
Zfish    17 RSAAGMAQLLWVF-----LVLAVMVRDAFSQRIIGGQ---EVVPYSIKY--QVSLQ--------- 62

  Fly    67 GVSYQHFCGGSLISDRWILSAAHCVWRK--------NIHYIAAFIGYENIENIGQLQPYGLESVE 123
             |..:|||||:||..:|:|:|||| ||.        :.|.:|...|:|.:..:.::       ..
Zfish    63 -VDRKHFCGGTLIQPQWVLTAAHC-WRPASVIQVVLSEHNLAVEEGFEQVCTVAKV-------FS 118

  Fly   124 YIYFQPSNFRNDIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNE-----SCRIIGYGATH--- 180
            ::.:.|..|.|||.::  |....:.....:|.|.||    ..|..|     ||.:.|:|.|.   
Zfish   119 HVAYNPKTFNNDIMII--KLTAPAQINAYVQPALLP----TADTPELAGGSSCTVSGWGVTRLYN 177

  Fly   181 -HAGPCQKRLFEAEV----------RVIDNQKCRDIIGHIWAPQNGANTVCALGN---NQDSCQG 231
             :..|. .|..:.|:          ||.||.                  :|| |:   .:|||||
Zfish   178 FYLSPI-LRAVDVEIFSSCQLYYYYRVNDNM------------------ICA-GSRFGGKDSCQG 222

  Fly   232 DSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWVQLLMQS 282
            ||||||||    ..|:.|:||.|:.|.:|..|.:||..|.|..|:..::.:
Zfish   223 DSGGPLIC----DGYLEGIVSWGIGCALPYYPGVYTKVRNYNRWIDWIIST 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 83/272 (31%)
Tryp_SPc 34..276 CDD:214473 82/271 (30%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 82/272 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.