DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and zgc:92590

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:270 Identity:79/270 - (29%)
Similarity:120/270 - (44%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLHSLFIISVLESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLIS 80
            ::.:|.:::|  :|.|    ..:|:.....|.:..|:.:.|      ...||   |.:||.|||:
Zfish     4 IVFALLVLAV--ACSA----DDKIIGGYECSPNSQPWQIYL------TYDNG---QRWCGASLIN 53

  Fly    81 DRWILSAAHCVW---RKNIHYIAAFIGYENIE-NIGQLQPYGLESV-EYIYFQPSNFRNDIALLY 140
            |||.:|||||..   |..:|     :|..|:. ..|..|....|.| .:..:......||..|:.
Zfish    54 DRWAVSAAHCYLVANRLTVH-----LGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIK 113

  Fly   141 MKRRYWSDFGNGLQYAQ-LPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEA-EVRVIDNQKCR 203
            :|..  :.|.   ||.| :|.......:.|.|.:.|:|...:.|.....:.:. .:.|:...:|.
Zfish   114 LKEP--AVFN---QYVQPVPLTTSCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTRAQCE 173

  Fly   204 DIIGHIWAPQNGANTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIY 266
            ...|  |  |...|..||  :...:|:||||||||:||  .|:  :.|:||.|..|...|.|.:|
Zfish   174 GAYG--W--QITKNMFCAGFMEGGKDACQGDSGGPVIC--NGE--LRGVVSWGYGCADSGYPGVY 230

  Fly   267 TVTRPYYDWV 276
            |....|.|||
Zfish   231 TEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 75/252 (30%)
Tryp_SPc 34..276 CDD:214473 73/250 (29%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 73/246 (30%)
Tryp_SPc 21..243 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.