DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG11668

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:272 Identity:69/272 - (25%)
Similarity:119/272 - (43%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQH---------FCGGSLISDRWILSAAH 89
            :||||:     :..:::|:|.:|.   ..:.||...::|         .||.::|:.|:.::|||
  Fly   148 LVGGRL-----TQENEHPYMCALG---WPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAH 204

  Fly    90 CVWRKNIHYIAAFIGYENIE-NIGQLQPYGLESV-EYIYFQPSNFRNDIALLYMKRR-------Y 145
            |..........|.||  .:| |.|:.|...::.: ::.:|......||:|::.:.||       .
  Fly   205 CASVGGESPSVALIG--GVELNSGRGQLIEIKRISQHPHFDAETLTNDLAVVKLARRSHMPVACL 267

  Fly   146 WSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIW 210
            |:.       ..||...:        ..:|||.|..|||....|.:..:..::.|:|:..:.:..
  Fly   268 WNQ-------ESLPERPL--------TALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYD 317

  Fly   211 APQN--GANTVCA--LGNNQDSCQGDSGGPLICTYGGK------DYIYGLVSHGLTCGIPGMPSI 265
            ...|  |:..:||  ...|.|:|||||||||:.....:      .|:.|:.|.|..|. .|.|.:
  Fly   318 KLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA-SGQPGV 381

  Fly   266 YTVTRPYYDWVQ 277
            |.....|..|::
  Fly   382 YVRIAHYIQWIE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 69/270 (26%)
Tryp_SPc 34..276 CDD:214473 68/269 (25%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 69/271 (25%)
Tryp_SPc 149..392 CDD:214473 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456090
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.