DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG10041

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:127/267 - (47%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HAVPIVGGRIVST-VGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVW- 92
            ::.|::...:.:| |.|...:||::||:.:     ...|. |:|.|.|.::|:.::||||||:. 
  Fly    29 NSTPLLATTVSTTKVISFRPRYPYIVSIGE-----NLKGY-YKHLCVGVILSNEFVLSAAHCIQT 87

  Fly    93 --RKNIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR----NDIALLYMKRRYWSD--- 148
              .|.: |:|.  |.:::.:..|.:.:.:|.    .:.| .||    ||||:|.:..::..|   
  Fly    88 NPTKQL-YVAG--GADSLNSRKQTRFFVVER----RWHP-QFRVLGGNDIAVLRIYPKFPLDDVR 144

  Fly   149 FGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIW-AP 212
            | ..:.:|..|    :.|......::|:|.. ..|..:| |.|.....::|.:|:.....:: .|
  Fly   145 F-RSINFAGKP----QRDSGTQASLVGWGRV-GVGKIRK-LQEMPFLTMENDECQQSHRFVFLKP 202

  Fly   213 QNGANTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDW 275
            .:    :||  |...:..|.||||.||:..  .|:.:|||:|:|.....|..|..:|....|..|
  Fly   203 LD----ICAMHLKGPRGPCDGDSGAPLMNV--AKEKLYGLLSYGRKACTPLKPYAFTRINAYSSW 261

  Fly   276 VQLLMQS 282
            :|..|.|
  Fly   262 IQESMDS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 68/256 (27%)
Tryp_SPc 34..276 CDD:214473 67/255 (26%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 65/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.