DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG16749

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:261 Identity:74/261 - (28%)
Similarity:124/261 - (47%) Gaps:37/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 HAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRK 94
            |..|.: ||:|:...||..||||::|::         |.|..|.||||:||.:::::||||...:
  Fly    22 HGAPQM-GRVVNGTDSSVEKYPFVISMR---------GSSGSHSCGGSIISKQFVMTAAHCTDGR 76

  Fly    95 NIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQP-SNFRNDIALLYMKRRYWSDFGNGLQYAQL 158
            ....::...|...|...|.......:.:::..:.| :|:.|||:||.::..:..| |..:...:|
  Fly    77 KASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNPYNNYANDISLLLVEEPFEFD-GVTVAPVKL 140

  Fly   159 PPHGMKPDQNESCR---IIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIWAPQNGANT-- 218
            |.......|.::..   :||:|.....|..|..|.|.|::|..:::|.:        ::|..|  
  Fly   141 PELAFATPQTDAGGEGVLIGWGLNATGGYIQSTLQEVELKVYSDEECTE--------RHGGRTDP 197

  Fly   219 ---VCALG---NNQDSCQGDSGGPLICTYGGKDYIYGLVSHGL-TCGIPGMPSIYTVTRPYYDWV 276
               :|. |   ..:..|.||||||||  |.|:.  .|:||..: .|.:...|.:|.....|.||:
  Fly   198 RYHICG-GVDEGGKGQCSGDSGGPLI--YNGQQ--VGIVSWSIKPCTVAPYPGVYCKVSQYVDWI 257

  Fly   277 Q 277
            :
  Fly   258 K 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 72/255 (28%)
Tryp_SPc 34..276 CDD:214473 71/254 (28%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 70/250 (28%)
Tryp_SPc 30..259 CDD:238113 70/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.