DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG12951

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:280 Identity:81/280 - (28%)
Similarity:129/280 - (46%) Gaps:50/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLFIISVLESCHAVPIVG------GRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSY--QHFCG 75
            ||.:|.:|    ||..||      .|:|:...||..||||:|||:           ||  .|.||
  Fly     8 SLSLIVIL----AVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLR-----------SYDGSHSCG 57

  Fly    76 GSLISDRWILSAAHCVWRKNIHYIAAFIGYENIENIGQLQPYGLES-VEYIYFQPSNFR-NDIAL 138
            ||:||..::::||||...:....::...|..||..:|. ...|::. :::..|.|:... |||:|
  Fly    58 GSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGP-NVVGIKKIIQHEDFDPTRQNANDISL 121

  Fly   139 LYMKRRYWSDFGNGLQYAQLPPHGMKPDQNES---CRIIGYGATHHAGPCQKRLFEAEVRVIDNQ 200
            |.::..:..| |..:...:||.......|:::   ..:||:|.....|..|..|.|..:::..::
  Fly   122 LMVEEPFEFD-GVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDE 185

  Fly   201 KCRDIIGHIWAPQNGANT----VCALG---NNQDSCQGDSGGPLICTYGGKDYIYGLVSHGL-TC 257
            :|.       :..||...    :|. |   ..:..|.||||||||  |.|:.  .|:||..: .|
  Fly   186 ECT-------SRHNGQTDPKYHICG-GVDEGGKGQCSGDSGGPLI--YNGQQ--VGIVSWSIKPC 238

  Fly   258 GIPGMPSIYTVTRPYYDWVQ 277
            .:...|.:|.....|.||::
  Fly   239 TVAPYPGVYCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 75/263 (29%)
Tryp_SPc 34..276 CDD:214473 74/262 (28%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 72/252 (29%)
Tryp_SPc 30..260 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.