DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG14642

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster


Alignment Length:277 Identity:76/277 - (27%)
Similarity:124/277 - (44%) Gaps:69/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCV--------WR 93
            ||:::..|    :||.|.:   |...:....|.|:  |||||||:|::|:||||.        |.
  Fly   146 GRVLARPG----EYPHMAA---VGFESDRGQVDYK--CGGSLISERFVLTAAHCTSIYEAPPKWV 201

  Fly    94 KNIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR-----NDIALLYMKR---------- 143
            :        ||..::.:..:.....|..:|.::..| |::     :|||||.:::          
  Fly   202 R--------IGDLDLASEKRSVEAQLLRIEQVFAHP-NYKKKMYYDDIALLKLEKEVELTEYVRP 257

  Fly   144 -RYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIG 207
             |.|       .:.:||        ......:|||||..|.|...||....:.|:.|.:|...:.
  Fly   258 VRLW-------VFPELP--------TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELP 307

  Fly   208 HIWAPQNGA--NTVCALGN--NQDSCQGDSGGPLICTYGGKD-------YIYGLVSHGLTCGIPG 261
            .:....:|.  :.:||...  |:|:|||||||||.....|:.       ::.|:.|:|:.|. ..
  Fly   308 PLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SS 371

  Fly   262 MPSIYTVTRPYYDWVQL 278
            .||:||....:.||::|
  Fly   372 YPSVYTRVSSFLDWIEL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 75/274 (27%)
Tryp_SPc 34..276 CDD:214473 74/273 (27%)
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 75/274 (27%)
Tryp_SPc 146..386 CDD:214473 74/273 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.