DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and mas

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:120/258 - (46%) Gaps:32/258 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHYIAAF 102
            |:|........::.:.|:|     .|:.|    |:.||.:||..:|:|:|||||  .||......
  Fly   802 RVVGGEDGENGEWCWQVAL-----INSLN----QYLCGAALIGTQWVLTAAHCV--TNIVRSGDA 855

  Fly   103 IGYENIENIGQLQPYGLESVE-------YIYFQPSN--FRNDIALLYMKRRYWSDFGNGLQYAQL 158
            | |..:.:....:.||....:       ||:...::  ..||||||  |....::..:|:....|
  Fly   856 I-YVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQTLDNDIALL--KLHGQAELRDGVCLVCL 917

  Fly   159 PPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIW-----APQNGANT 218
            |..|:.....:.|.:.|||....|||...|:.|||:.::.:.:|...:..:.     .|   |::
  Fly   918 PARGVSHAAGKRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILP---ASS 979

  Fly   219 VCALG-NNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWVQLLM 280
            .||.| ...|:||||.||||:|...|...:.||||.|..||...:|.:|..|..:..|:..::
  Fly   980 FCAGGEEGHDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQII 1042

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 76/253 (30%)
Tryp_SPc 34..276 CDD:214473 75/252 (30%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 75/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456116
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.