DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG32277

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:279 Identity:79/279 - (28%)
Similarity:126/279 - (45%) Gaps:63/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YWLLHSLFIISVLESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSL 78
            |.||..|.::..||......:..|:|.....:....:.|:|:|:        .|..::  |||.:
  Fly     2 YILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLR--------RGGKFR--CGGVI 56

  Fly    79 ISDRWILSAAHCVWRKNIHYIAAFIGYENIENI----------GQLQPYGLESVEYIYFQPS--- 130
            ||...:|:||||:..:          |:.:.::          ..:.|..:.|..|:...|:   
  Fly    57 ISPNCVLTAAHCLEGR----------YQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCA 111

  Fly   131 --NFRNDIALLYMKRRYWSDF-GNG----LQYAQLPPHGMKPDQNESCRIIGYGAT----HHAGP 184
              ...:|:|::.:.|.:  |. ||.    :.|..||||       .:..::|:||.    |:...
  Fly   112 QRGLDSDLAVIRLSRPF--DIAGNASLVKIDYNDLPPH-------SNLTVLGWGAINEQGHNWNQ 167

  Fly   185 CQKRLFEAEVRVIDNQKCRDIIGHIWAPQNGANTVCALGNN-QDSCQGDSGGPLICTYGGKDYIY 248
            |   |.||.|::|.:::|...:|..|..... |..||||.| :|:||||||||.|  |.|:.  .
  Fly   168 C---LQEANVKLISHRECIKSVGSGWQKVTN-NMFCALGKNARDACQGDSGGPAI--YAGRS--V 224

  Fly   249 GLVSHGLTCGIPGMPSIYT 267
            |:||.|..|| .|.|.:||
  Fly   225 GIVSWGYGCG-SGYPGVYT 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 73/259 (28%)
Tryp_SPc 34..276 CDD:214473 73/259 (28%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 72/255 (28%)
Tryp_SPc 27..246 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468954
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.