DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and KLKB1

DIOPT Version :10

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:263 Identity:77/263 - (29%)
Similarity:120/263 - (45%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHC--------VWRK 94
            |||....||..::|:.||||..:|       :.:|.||||||..:|:|:||||        ||| 
Human   401 RIVGGTNSSWGEWPWQVSLQVKLT-------AQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWR- 457

  Fly    95 NIHYIAAFIGYENIENIGQLQPYG--LESVEYIYFQPSNFRNDIALLYMKRRYWSDFGNGLQYAQ 157
                  .:.|..|:.:|.:..|:.  .|.:.:..::.|...:||||:.::.        .|.|.:
Human   458 ------IYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQA--------PLNYTE 508

  Fly   158 ------LPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGHIWAPQNGA 216
                  ||..|.......:|.:.|:|.:...|..|..|.:..:.::.|::|:.........|   
Human   509 FQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQ--- 570

  Fly   217 NTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWVQLL 279
            ..|||  ....:|:|:|||||||:|.:.|...:.|:.|.|..|.....|.:||....|.||:...
Human   571 RMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEK 635

  Fly   280 MQS 282
            .||
Human   636 TQS 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 75/256 (29%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.