DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG4927

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:120/277 - (43%) Gaps:45/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCHAVP-IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCV 91
            ||...| ||||     ..::..::|||.    ::.:...|.......||..:|..:::|:||||:
  Fly    98 SCRTTPFIVGG-----AKAAGREFPFMA----LLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCL 153

  Fly    92 ---WRKNIHYIAAFIGYENIENIGQL---------QPYGLESVEYIYF-------QPSNFRNDIA 137
               ..|.......:.|.:.:..:|:|         ||.....:.|:..       ...:.:||||
  Fly   154 ETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIA 218

  Fly   138 LLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNESCRI--IGYGATHHAGPCQKRLFEAEVRVIDNQ 200
            ::.::..  :.|...:..|.||..|    .||..::  .|:|||..:|.....|.:..:...|..
  Fly   219 VVELEME--ATFSEYVAPACLPLDG----GNEQLQVAAAGWGATSESGHASSHLLKVSLDRYDVA 277

  Fly   201 KCRDIIGHIWAPQNGANTVCA--LGNNQDSCQGDSGGPLIC---TYGGKDYIYGLVSHGLTCGIP 260
            :|...:.|   ..:....:||  ...:.|:|.||||||:..   .|.....:.|:.|:||.||:.
  Fly   278 ECSQRLEH---KIDVRTQLCAGSRSTSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLVCGVQ 339

  Fly   261 GMPSIYTVTRPYYDWVQ 277
            |:||:||....|.||::
  Fly   340 GLPSVYTKVHLYTDWIE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 68/268 (25%)
Tryp_SPc 34..276 CDD:214473 67/267 (25%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 68/270 (25%)
Tryp_SPc 105..355 CDD:214473 67/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456084
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.