DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG1773

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:319 Identity:82/319 - (25%)
Similarity:121/319 - (37%) Gaps:104/319 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WLLHSLFIISVL--ESC----HAVP-------IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTN 66
            |..|.|.....|  :.|    :.:|       |.|||     .||....|:|..|.       .:
  Fly    30 WTPHELLAYEQLTQQDCGVLSNLIPAQRLRRRITGGR-----KSSLLSQPWMAFLH-------IS 82

  Fly    67 GVSYQHFCGGSLISDRWILSAAHC-----------VWRKNIHYIAAFIGYENIENIGQLQPYGLE 120
            |......|||||:|:.::|:||||           ||          :|..:|.:......|..:
  Fly    83 GDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVW----------LGELDISSTSDCVTYNYQ 137

  Fly   121 SV-----------------EYIYFQPSNFRNDIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQ- 167
            .|                 |:..|.|.   .||||:.:.::.  .|.:.::...||    ..|: 
  Fly   138 RVCALPVEEFTIDKWILHEEFNLFYPG---YDIALIKLNKKV--VFKDHIRPICLP----LTDEL 193

  Fly   168 -------NESCRIIGYGATHHAGPCQKRLFEAEVRV-IDNQKCRDIIGHIWAPQNGANT--VCAL 222
                   .:|...:|:|.|.     .:|...:.:.| |:.:||.|          |.:|  :||.
  Fly   194 LAFTLQLGQSYMAVGWGRTE-----SRRFANSTMEVHINTEKCTD----------GRDTSFLCAN 243

  Fly   223 GNNQDSCQGDSGGPLI--CTYGGK--DYIYGLVSHG-LTCGIPGMPSIYTVTRPYYDWV 276
            |:..|:|.||||||||  .|..||  ...:|:||.| ..|| .|..:.|.....|..|:
  Fly   244 GDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 76/287 (26%)
Tryp_SPc 34..276 CDD:214473 75/285 (26%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 75/286 (26%)
Tryp_SPc 62..301 CDD:238113 75/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.