DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and gd

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:308 Identity:70/308 - (22%)
Similarity:114/308 - (37%) Gaps:88/308 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCV 91
            :|..::|.:      |.||    :|::.:    |..|....:.:|  |||||:|.|.::|:|||.
  Fly   249 DSADSLPSI------TRGS----WPWLAA----IYVNNLTSLDFQ--CGGSLVSARVVISSAHCF 297

  Fly    92 WRKNIHY----IAAFIGYENIEN---IGQLQPYGLESVEYIYFQP------SNFRNDIALLYMKR 143
            ...|..|    :..|:|..|::|   .|.|    ...|:.||..|      |::..|||::.:|.
  Fly   298 KLFNKRYTSNEVLVFLGRHNLKNWNEEGSL----AAPVDGIYIHPDFNSQLSSYDADIAVIILKD 358

  Fly   144 R-----------YWSDFGNGLQYAQLPPHGM-----------KPDQNESCRIIGYGATHHAGPCQ 186
            .           .||  |:......:...|:           ..||..|..:.|..:|..:.|  
  Fly   359 EVRFNTFIRPACLWS--GSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTDASAP-- 419

  Fly   187 KRLFEAEVRVIDNQKCRDIIGHIWAPQNGANTVCA--LGNNQDSCQ-------GDSGGPLICTYG 242
             ::.:|.  ::.|.:|.....| :...:...|.||  ....:|:.|       |.||..|.....
  Fly   420 -KVVKAP--IVGNAECFRANAH-FRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGLFIRRN 480

  Fly   243 GKDYIYGLV--------------SHGLTCGIPGMPSIYTVTRPYYDWV 276
            .:..:.|.|              ||.|.|  .....||.....:.||:
  Fly   481 NRWMLRGTVSAALPAVETPDAESSHKLCC--KNQYIIYADVAKFLDWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 68/301 (23%)
Tryp_SPc 34..276 CDD:214473 67/299 (22%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 67/298 (22%)
Tryp_SPc 258..526 CDD:214473 67/291 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456169
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.