DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG32260

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:272 Identity:70/272 - (25%)
Similarity:117/272 - (43%) Gaps:41/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVW 92
            :|........|:|..:.:....||::.:| .....|..|.:.:  .||||||..|:::::|||: 
  Fly   317 TCGISGATSNRVVGGMEARKGAYPWIAAL-GYFEENNRNALKF--LCGGSLIHSRYVITSAHCI- 377

  Fly    93 RKNIHYIAAFIGYENIENIGQLQPYGL---ESVEYIYFQPSNFRNDIALLYMKRRYWSDFG---- 150
              |.......:|..::....:.....|   .:|.:.:|..::..|||||:.:     :..|    
  Fly   378 --NPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIEL-----NVVGALPG 435

  Fly   151 --------NGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIG 207
                    ...::.|....||.|      .:.|:||..|.|...:.|.:|:|.::....|.....
  Fly   436 NISPICLPEAAKFMQQDFVGMNP------FVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYK 494

  Fly   208 HIWA-PQNGANTVCALGNNQDSCQGDSGGPLIC------TYGGKDYIYGLVSHGLTCGIPGMPSI 265
            .|:. .|.....:||..::.|:|||||||||:.      .|  :.|:.||||.|..|..|..|.:
  Fly   495 SIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVY--RFYLLGLVSFGYECARPNFPGV 557

  Fly   266 YTVTRPYYDWVQ 277
            ||....|..|::
  Fly   558 YTRVASYVPWIK 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 69/264 (26%)
Tryp_SPc 34..276 CDD:214473 68/263 (26%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 68/259 (26%)
Tryp_SPc 328..571 CDD:238113 68/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468955
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.