DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and LOC312273

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:247 Identity:70/247 - (28%)
Similarity:110/247 - (44%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAAHCVWRKNIHYIAAF 102
            |||..........|:.|||.           :..|.||||||:|:|:||||||...:    :...
  Rat    24 RIVGGYTCQEHSVPYQVSLN-----------AGSHICGGSLITDQWVLSAAHCYHPQ----LQVR 73

  Fly   103 IGYENIENIGQLQPYGLESVEYIY---FQPSNFRNDIALLYMKRRYWSDFGNGLQYAQLPPHGMK 164
            :|..||..|...:.: :::.:.|.   :......|||.|:.:|..  :...:.:....||.:  .
  Rat    74 LGEHNIYEIEGAEQF-IDAAKMILHPDYDKWTVDNDIMLIKLKSP--ATLNSKVSTIPLPQY--C 133

  Fly   165 PDQNESCRIIGYGATHHAGPCQKRLFEAE--VRVIDNQKCRDIIGHIWAPQNGANTVCALG---N 224
            |.....|.:.|:|..       |..||:.  ::.:|.....|.:.|...|:...|.:..||   .
  Rat   134 PTAGTECLVSGWGVL-------KFGFESPSVLQCLDAPVLSDSVCHKAYPRQITNNMFCLGFLEG 191

  Fly   225 NQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWV 276
            .:||||.|||||::|  .|:  :.|:||.|..|.:.|.|.:||....|.:|:
  Rat   192 GKDSCQYDSGGPVVC--NGE--VQGIVSWGDGCALEGKPGVYTKVCNYLNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 70/247 (28%)
Tryp_SPc 34..276 CDD:214473 69/245 (28%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.