DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and CG30083

DIOPT Version :10

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:225 Identity:56/225 - (24%)
Similarity:97/225 - (43%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGGSLISDRWILSAAHCVWRKNI-----------HYIAAFIGYENIENIGQLQPYGLESVEYIYF 127
            |||:||..:::||||||:.|..|           .|.|....:.|                 .||
  Fly    64 CGGTLIHKQFVLSAAHCIKRDQILAVRLGEHSSSRYFAVTKAFRN-----------------KYF 111

  Fly   128 QPSNFRNDIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEA 192
            ...::.|||.:|.::...  .|...::...:.....|....::.:..|:|.|.:. ...|.|...
  Fly   112 TTGSYSNDIGILRIQPIV--KFNAVIRPICIITDPTKVPNVKTFKAAGWGKTENE-TFSKVLKTV 173

  Fly   193 EVRVIDNQKCRDIIGHIWAPQNGANTVCALGNNQDSCQGDSGGPLICTY---GGKDYI-YGLVSH 253
            |:..::..:|.::   :|.... .:.:||...:.|:|.||||||||...   |...|: .|::|.
  Fly   174 ELNELNASECYNM---LWVNVT-ESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISF 234

  Fly   254 GLT-CGIPGMPSIYTVTRPYYDWVQLLMQS 282
            |.: |..||   :||....:.||:.:::.:
  Fly   235 GSSLCNSPG---VYTRLSSFIDWILMVVDN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 56/218 (26%)
CG30083NP_725492.3 Tryp_SPc 34..255 CDD:238113 55/217 (25%)

Return to query results.
Submit another query.