DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34290 and Gm2663

DIOPT Version :9

Sequence 1:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001096130.1 Gene:Gm2663 / 100040208 MGIID:3780832 Length:247 Species:Mus musculus


Alignment Length:280 Identity:84/280 - (30%)
Similarity:124/280 - (44%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LFIISVLESCHAVP------IVGGRIVSTVGSSTSKY--PFMVSLQDVITRNTTNGVSYQHFCGG 76
            :|..:.|.:..|:|      |||       |.:..|:  |:.|||.|        |:|:|  |||
Mouse     4 IFFFTFLGAAVALPANSDDKIVG-------GYTCPKHSVPYQVSLND--------GISHQ--CGG 51

  Fly    77 SLISDRWILSAAHCVWRK--------NIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFR 133
            |||:|:|:||||||..|:        ||..:.....:.:.|.|.:...|..::|:          
Mouse    52 SLINDQWVLSAAHCYKRRLQVRLGEHNIDVLEGGEQFIDAEKIIRHPDYNKDTVD---------- 106

  Fly   134 NDIALLYMKRRYWSDFGNGLQYAQLPPHGMKPDQNESCRIIGYGATHHAGPCQKRLFEA-EVRVI 197
            |||.|:.:|..  :...:.:....||  ......|..|.:.|:|.|...|.....|.:. |..|:
Mouse   107 NDIMLIKLKSP--AILNSQVSTVSLP--RSCASTNAQCLVSGWGNTVSIGGKYPALLQCLEAPVL 167

  Fly   198 DNQKCRDIIGHIWAPQNGANTVCA--LGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIP 260
            ....|:    ..:..|..:|..|.  |...:|||.||||||::|  .|:  |.|:||.|..|.:.
Mouse   168 SASSCK----KSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVC--NGE--IQGIVSWGSVCAMR 224

  Fly   261 GMPSIYTVTRPYYDWVQLLM 280
            |.|.:||....|..|:|..|
Mouse   225 GKPGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 78/255 (31%)
Tryp_SPc 34..276 CDD:214473 77/254 (30%)
Gm2663NP_001096130.1 Tryp_SPc 23..240 CDD:214473 77/255 (30%)
Tryp_SPc 24..243 CDD:238113 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.