DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-MWFE and ND-MWFE

DIOPT Version :10

Sequence 1:NP_001097297.1 Gene:ND-MWFE / 5740593 FlyBaseID:FBgn0085468 Length:123 Species:Drosophila melanogaster
Sequence 2:XP_316660.2 Gene:ND-MWFE / 1277216 VectorBaseID:AGAMI1_000027 Length:70 Species:Anopheles gambiae


Alignment Length:70 Identity:46/70 - (65%)
Similarity:55/70 - (78%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQRDFRLTDNPYKMNGLE 65
            |||||||...|||.:||||.:|:|||.||.:.||:|||.|||:.|:||.||.|||.|||:.||||
Mosquito     1 MWFEILPSFGIITAVLSVPGFALYGLHKLTLDNAYRRNTDERWDRIMYTRDMRLTGNPYQCNGLE 65

  Fly    66 QIPDE 70
            .|||:
Mosquito    66 SIPDK 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-MWFENP_001097297.1 MWFE 2..55 CDD:464920 33/52 (63%)
PRK11778 93..>121 CDD:236978
ND-MWFEXP_316660.2 MWFE 2..56 CDD:464920 34/53 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.