DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and MYOT

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_006781.1 Gene:MYOT / 9499 HGNCID:12399 Length:498 Species:Homo sapiens


Alignment Length:241 Identity:62/241 - (25%)
Similarity:100/241 - (41%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPM 212
            |:| :..|..||...|.|..         |...|||.  |....::.:.:|...|::...:|.|.
Human   226 QVR-SRSTSRGDVNDQDAIQ---------EKFYPPRF--IQVPENMSIDEGRFCRMDFKVSGLPA 278

  Fly   213 PNVTWSRKNNILPN--------GEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHV 269
            |:|:|......:.:        .|:.|||  |..|.|.....|.|.|.|.||.|: |:..|.|.|
Human   279 PDVSWYLNGRTVQSDDLHKMIVSEKGLHS--LIFEVVRASDAGAYACVAKNRAGE-ATFTVQLDV 340

  Fly   270 L-----------FSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFK--DTMQLDTTERHIM 321
            |           :.|:   .:.|:   ||....|.|.:.....|::.|.:  :.:|.:|....:.
Human   341 LAKEHKRAPMFIYKPQ---SKKVL---EGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLY 399

  Fly   322 ETRGSRHTLIIRKVHPQDFGNYSCVAENQLG--KARKTLQLSGKPN 365
            :....|.||:|:.|:.:|.|.|:..|.|:.|  .....|.::.:||
Human   400 QDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPN 445

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 8/31 (26%)
Ig strand B 103..107 CDD:409353
Ig strand C 116..120 CDD:409353