DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and MYOT

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_006781.1 Gene:MYOT / 9499 HGNCID:12399 Length:498 Species:Homo sapiens


Alignment Length:241 Identity:62/241 - (25%)
Similarity:100/241 - (41%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 QIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPM 212
            |:| :..|..||...|.|..         |...|||.  |....::.:.:|...|::...:|.|.
Human   226 QVR-SRSTSRGDVNDQDAIQ---------EKFYPPRF--IQVPENMSIDEGRFCRMDFKVSGLPA 278

  Fly   213 PNVTWSRKNNILPN--------GEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHV 269
            |:|:|......:.:        .|:.|||  |..|.|.....|.|.|.|.||.|: |:..|.|.|
Human   279 PDVSWYLNGRTVQSDDLHKMIVSEKGLHS--LIFEVVRASDAGAYACVAKNRAGE-ATFTVQLDV 340

  Fly   270 L-----------FSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFK--DTMQLDTTERHIM 321
            |           :.|:   .:.|:   ||....|.|.:.....|::.|.:  :.:|.:|....:.
Human   341 LAKEHKRAPMFIYKPQ---SKKVL---EGDSVKLECQISAIPPPKLFWKRNNEMVQFNTDRISLY 399

  Fly   322 ETRGSRHTLIIRKVHPQDFGNYSCVAENQLG--KARKTLQLSGKPN 365
            :....|.||:|:.|:.:|.|.|:..|.|:.|  .....|.::.:||
Human   400 QDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTRLDVTARPN 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 8/31 (26%)
Ig 103..177 CDD:143165 7/28 (25%)
IG_like 191..269 CDD:214653 24/85 (28%)
IGc2 198..258 CDD:197706 20/67 (30%)
I-set 273..360 CDD:254352 22/90 (24%)
Ig 290..359 CDD:143165 17/72 (24%)
FN3 <466..524 CDD:238020
MYOTNP_006781.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..151
Necessary for interaction with ACTN1 79..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..241 5/15 (33%)
Necessary for interaction with ACTA1. /evidence=ECO:0000269|PubMed:12499399 215..498 62/241 (26%)
Necessary for interaction with FLNC 215..493 62/241 (26%)
Ig 249..333 CDD:299845 25/88 (28%)
I-set 250..340 CDD:254352 27/94 (29%)
I-set 349..440 CDD:254352 22/96 (23%)
Ig_Myotilin_C 366..440 CDD:143300 18/73 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.