DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr21

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:248 Identity:60/248 - (24%)
Similarity:95/248 - (38%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGHIRDRRVGSLPHILFLAIAVVSLHF--ESVSAQSMMTKNEPMF-ISRSETFKFITGETIVLPC 107
            |.|.|:.            :.|..|:.  |::.....:....|.| .|.::....:.|.|..|.|
  Fly    21 PQHFREN------------VTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNC 73

  Fly   108 EVANTDTYVVAW--KRGIAILTAGSVKVTPDPRV-----RLVNGFNLQIRDALPTDAGDYICQIA 165
            .:.|.....|:|  .|.:.:||......|.|.|.     :....::|||:.....|:|.|.||::
  Fly    74 RIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVS 138

  Fly   166 TMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMP--NVTWSRKNNIL---- 224
            |..|...|....::.|  |..|..|..:.:..||:|.:.|.....|.|  :|.|:..|..:    
  Fly   139 TTPPVGYTMVFSVVEP--ITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDS 201

  Fly   225 PNG-----EEK--LHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVL 270
            |.|     .||  :.:..|.|:.......|.|.|..:|    ..|..|.:|:|
  Fly   202 PRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHIL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/86 (28%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 2/5 (40%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 1/2 (50%)
Ig 182..269 CDD:472250 24/99 (24%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046
FN3 <466..524 CDD:238020
dpr21NP_001163838.2 Ig 71..149 CDD:472250 22/77 (29%)
Ig strand C 82..86 CDD:409353 1/3 (33%)
Ig strand E 118..122 CDD:409353 1/3 (33%)
Ig strand F 132..137 CDD:409353 2/4 (50%)
Ig 169..249 CDD:472250 21/83 (25%)
Ig strand B 172..176 CDD:409353 1/3 (33%)
Ig strand C 187..191 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.