DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr21

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:248 Identity:60/248 - (24%)
Similarity:95/248 - (38%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PGHIRDRRVGSLPHILFLAIAVVSLHF--ESVSAQSMMTKNEPMF-ISRSETFKFITGETIVLPC 107
            |.|.|:.            :.|..|:.  |::.....:....|.| .|.::....:.|.|..|.|
  Fly    21 PQHFREN------------VTVTDLYLISENIVPMKRVLDRGPYFDTSATKNVTSLVGITGHLNC 73

  Fly   108 EVANTDTYVVAW--KRGIAILTAGSVKVTPDPRV-----RLVNGFNLQIRDALPTDAGDYICQIA 165
            .:.|.....|:|  .|.:.:||......|.|.|.     :....::|||:.....|:|.|.||::
  Fly    74 RIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVS 138

  Fly   166 TMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMP--NVTWSRKNNIL---- 224
            |..|...|....::.|  |..|..|..:.:..||:|.:.|.....|.|  :|.|:..|..:    
  Fly   139 TTPPVGYTMVFSVVEP--ITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDS 201

  Fly   225 PNG-----EEK--LHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVL 270
            |.|     .||  :.:..|.|:.......|.|.|..:|    ..|..|.:|:|
  Fly   202 PRGGVSVITEKGDITTSYLLIQRASIADSGQYTCLPSN----ANSKSVNVHIL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/86 (28%)
Ig 103..177 CDD:143165 22/80 (28%)
IG_like 191..269 CDD:214653 21/90 (23%)
IGc2 198..258 CDD:197706 19/72 (26%)
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
dpr21NP_001163838.2 Ig 71..149 CDD:299845 22/77 (29%)
IG_like 71..140 CDD:214653 19/68 (28%)
IG_like 162..249 CDD:214653 21/90 (23%)
IGc2 169..242 CDD:197706 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.