DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and zgc:153911

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001070783.1 Gene:zgc:153911 / 768172 ZFINID:ZDB-GENE-061013-174 Length:288 Species:Danio rerio


Alignment Length:214 Identity:42/214 - (19%)
Similarity:85/214 - (39%) Gaps:59/214 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ISRSETFKFITGETIVLPC--------EVANTDTYVVAWKRGIAI------------------LT 127
            :.||....|. ||.::|||        ::::|   |:.|:||:.:                  ::
Zfish    25 VPRSPVIGFY-GEELILPCTFPVDSSWDLSST---VITWQRGLDVVHSFYYSRDQLDRQNPHYVS 85

  Fly   128 AGSVKVTPDPRVRLVNGFNLQIRDALPTDAGDYICQIATMDPRE----ITHTVEILVPPRIHH-- 186
            ..|:.:....|    ...:|::......|||.|.|.|:|....:    ..:...:...||:..  
Zfish    86 RTSLFIQEMQR----GNASLKLDKVTQRDAGVYTCSISTNSGSQKKSFAVNIAALYSEPRLQFSM 146

  Fly   187 ISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYIC 251
            ::.|.:|.|         .|..|.|.|.:.|..:|:.:.|   :..:|:....:.     |:||.
Zfish   147 LTDGVNLLV---------TSDGGYPSPTLQWLMENSDITN---QTQTHLRQDTST-----GLYIV 194

  Fly   252 TANNRVGQPASSQV--VLH 268
            ::..::...::|.:  :||
Zfish   195 SSWIKLSDVSNSSLTFILH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/109 (18%)
Ig 103..177 CDD:143165 18/103 (17%)
IG_like 191..269 CDD:214653 16/80 (20%)
IGc2 198..258 CDD:197706 11/59 (19%)
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
zgc:153911NP_001070783.1 V-set 28..122 CDD:284989 22/101 (22%)
IG_like 35..133 CDD:214653 20/104 (19%)
Ig <156..221 CDD:299845 14/66 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.