DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and iglon5

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:314 Identity:88/314 - (28%)
Similarity:141/314 - (44%) Gaps:31/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LPHILFLAIAVVSLHFESVS-AQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWK 120
            |.|.|.|.:|::   ::..| ||:....:.|      :....:.||::||.|::....|: .||.
Zfish     6 LRHALALLLALL---WKGPSGAQAAEFGHLP------DNITVLEGESVVLRCKIDEEVTH-KAWL 60

  Fly   121 RGIAILTAGSVKVTPDPRVRLVNG----FNLQIRDALPTDAGDYICQIATMDPREITHTVEIL-V 180
            ....||..|:.|.:.|.||.|.|.    |:::|...:..|.|.|.|.....:.....|...|: |
Zfish    61 NRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQV 125

  Fly   181 PPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSR-KNNILPNGEEKLHSHVLSIENVDRH 244
            |.||.:||.  ...|.:|..|.:.|.|.|.|.|.:||.. |..:|..||      .|.|..:.||
Zfish   126 PARIVNISQ--DKSVNEGEDVNLFCLAVGRPEPTITWKDFKYGLLNEGE------FLEITEIKRH 182

  Fly   245 KGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKD 309
            :...:.|..||.|..|.:.:|.:.|.:.|.|:..:.:. :..|..|.|.|...........|::|
Zfish   183 QAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMP-AQVGKTAILRCEAMAVPTASFEWYRD 246

  Fly   310 ---TMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQL 360
               .::.|.|.:  ::...:|..|:...|..:.||||:|.|.|:||.:..::.|
Zfish   247 DRRPVESDNTLK--IKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/84 (30%)
Ig strand B 103..107 CDD:409353 2/3 (67%)
Ig strand C 116..120 CDD:409353 1/3 (33%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 1/2 (50%)
Ig 182..269 CDD:472250 28/87 (32%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 1/4 (25%)
Ig strand G 262..265 CDD:409353 0/2 (0%)
Ig_3 273..349 CDD:464046 19/78 (24%)
FN3 <466..524 CDD:238020
iglon5NP_001017775.2 Ig 35..123 CDD:472250 24/88 (27%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 1/4 (25%)
Ig strand E 89..93 CDD:409353 1/3 (33%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 31/92 (34%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 1/3 (33%)
Ig strand E 172..176 CDD:409353 2/9 (22%)
Ig strand F 186..191 CDD:409353 1/4 (25%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 19/79 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.