DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and iglon5

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:314 Identity:88/314 - (28%)
Similarity:141/314 - (44%) Gaps:31/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LPHILFLAIAVVSLHFESVS-AQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWK 120
            |.|.|.|.:|::   ::..| ||:....:.|      :....:.||::||.|::....|: .||.
Zfish     6 LRHALALLLALL---WKGPSGAQAAEFGHLP------DNITVLEGESVVLRCKIDEEVTH-KAWL 60

  Fly   121 RGIAILTAGSVKVTPDPRVRLVNG----FNLQIRDALPTDAGDYICQIATMDPREITHTVEIL-V 180
            ....||..|:.|.:.|.||.|.|.    |:::|...:..|.|.|.|.....:.....|...|: |
Zfish    61 NRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQV 125

  Fly   181 PPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSR-KNNILPNGEEKLHSHVLSIENVDRH 244
            |.||.:||.  ...|.:|..|.:.|.|.|.|.|.:||.. |..:|..||      .|.|..:.||
Zfish   126 PARIVNISQ--DKSVNEGEDVNLFCLAVGRPEPTITWKDFKYGLLNEGE------FLEITEIKRH 182

  Fly   245 KGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKD 309
            :...:.|..||.|..|.:.:|.:.|.:.|.|:..:.:. :..|..|.|.|...........|::|
Zfish   183 QAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKNMP-AQVGKTAILRCEAMAVPTASFEWYRD 246

  Fly   310 ---TMQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQL 360
               .::.|.|.:  ::...:|..|:...|..:.||||:|.|.|:||.:..::.|
Zfish   247 DRRPVESDNTLK--IKNEKTRSLLLFTNVTEKHFGNYTCFASNRLGASNASMLL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 25/84 (30%)
Ig 103..177 CDD:143165 22/77 (29%)
IG_like 191..269 CDD:214653 24/78 (31%)
IGc2 198..258 CDD:197706 20/60 (33%)
I-set 273..360 CDD:254352 22/89 (25%)
Ig 290..359 CDD:143165 19/71 (27%)
FN3 <466..524 CDD:238020
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 25/96 (26%)
Ig 35..123 CDD:299845 24/88 (27%)
Ig 125..>183 CDD:299845 23/65 (35%)
I-set 128..207 CDD:254352 28/86 (33%)
IG_like 217..298 CDD:214653 20/83 (24%)
ig 223..296 CDD:278476 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4772
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.