| Sequence 1: | NP_001287571.1 | Gene: | CG34353 / 5740590 | FlyBaseID: | FBgn0085382 | Length: | 581 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017451354.1 | Gene: | Ntm / 50864 | RGDID: | 620958 | Length: | 367 | Species: | Rattus norvegicus |
| Alignment Length: | 336 | Identity: | 99/336 - (29%) |
|---|---|---|---|
| Similarity: | 154/336 - (45%) | Gaps: | 43/336 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 RTISKPGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVL 105
Fly 106 PCEVANTDTYVVAWKRGIAILTAGSVKVTPDPRVRLVNG----FNLQIRDALPTDAGDYICQIAT 166
Fly 167 MDPREITHTVEIL--VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPN--- 226
Fly 227 --GEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVER----PVVFSG 285
Fly 286 EGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHI-METRGSRHTLIIRKVHPQDFGNYSCVAEN 349
Fly 350 QLGKARKTLQL 360 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34353 | NP_001287571.1 | IG_like | 100..180 | CDD:214653 | 28/85 (33%) |
| Ig | 103..177 | CDD:143165 | 25/77 (32%) | ||
| IG_like | 191..269 | CDD:214653 | 24/82 (29%) | ||
| IGc2 | 198..258 | CDD:197706 | 21/64 (33%) | ||
| I-set | 273..360 | CDD:254352 | 29/91 (32%) | ||
| Ig | 290..359 | CDD:143165 | 23/69 (33%) | ||
| FN3 | <466..524 | CDD:238020 | |||
| Ntm | XP_017451354.1 | Ig | 44..132 | CDD:416386 | 28/89 (31%) |
| Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 64..70 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 64..70 | CDD:409353 | 4/6 (67%) | ||
| CDR2 | 71..83 | CDD:409353 | 5/11 (45%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 84..118 | CDD:409353 | 10/33 (30%) | ||
| Ig strand D | 87..94 | CDD:409353 | 3/6 (50%) | ||
| Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 123..132 | CDD:409353 | 2/8 (25%) | ||
| FR4 | 125..132 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 136..205 | CDD:404760 | 24/77 (31%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
| Ig strand F | 197..205 | CDD:409353 | 4/7 (57%) | ||
| Ig | 223..307 | CDD:416386 | 29/88 (33%) | ||
| putative Ig strand A | 223..229 | CDD:409353 | 3/5 (60%) | ||
| Ig strand B | 239..243 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 252..256 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 278..282 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 292..297 | CDD:409353 | 3/4 (75%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||