DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr12

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:286 Identity:67/286 - (23%)
Similarity:113/286 - (39%) Gaps:81/286 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ISKPGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNE---------------------- 85
            :.:|.|:.:.|:    .:|.|...:::...|. ..:|::|.|:                      
  Fly    12 LRRPLHLMELRI----LLLCLPTLLLATTLEP-DQKSILTDNDWKKLWMRGGINGDSKLDNNLDS 71

  Fly    86 ---PMF-----ISRSETFKFITGETIVLPCEVANTDTYVVAW-------KRGIAILTAGSVKVTP 135
               |||     ::.:.|.:.  |.|..|.|:|:..|...|.|       :|...||::|:...|.
  Fly    72 SDSPMFEDSELMAHNTTVQL--GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTN 134

  Fly   136 DPRVRLV-----NGFNLQIRDALPTDAGDYICQIATMDPRE-ITHTV--EILVPPRIHHISTGGH 192
            |.|..::     |.:.|||:.....|.|.|.||::|  |.. |:|.|  :::||...  |...|.
  Fly   135 DERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST--PTGIISHFVNLQVVVPEAF--ILGSGE 195

  Fly   193 LQVKKGSSVRIECSATGNPMP--NVTWSRKNNIL----------------PNGEEKLHSHVLSIE 239
            |.|..||::.:.|....:|.|  .|.|.:.:.::                |..:.:     |.|.
  Fly   196 LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSR-----LIIR 255

  Fly   240 NVDRHKGGVYICTANNRVGQPASSQV 265
            .......|.|.|:|:|.  :|||..|
  Fly   256 EPQVTDSGNYTCSASNT--EPASIYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 29/94 (31%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 2/10 (20%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 1/2 (50%)
Ig 182..269 CDD:472250 23/102 (23%)
Ig strand B 201..205 CDD:409353 0/3 (0%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046
FN3 <466..524 CDD:238020
dpr12NP_652462.3 IG_like 86..183 CDD:214653 30/100 (30%)
Ig strand B 95..99 CDD:409353 1/3 (33%)
Ig strand C 109..117 CDD:409353 2/7 (29%)
Ig strand E 149..153 CDD:409353 1/3 (33%)
Ig strand F 163..168 CDD:409353 2/4 (50%)
Ig strand G 176..179 CDD:409353 1/2 (50%)
Ig_3 195..271 CDD:464046 16/80 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.