DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr12

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:285 Identity:69/285 - (24%)
Similarity:111/285 - (38%) Gaps:79/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ISKPGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNE---------------------- 85
            :.:|.|:.:.|:    .:|.|...:::...|. ..:|::|.|:                      
  Fly    12 LRRPLHLMELRI----LLLCLPTLLLATTLEP-DQKSILTDNDWKKLWMRGGINGDSKLDNNLDS 71

  Fly    86 ---PMFISRSETFKFIT----GETIVLPCEVANTDTYVVAW-------KRGIAILTAGSVKVTPD 136
               ||| ..||.....|    |.|..|.|:|:..|...|.|       :|...||::|:...|.|
  Fly    72 SDSPMF-EDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTND 135

  Fly   137 PRVRLV-----NGFNLQIRDALPTDAGDYICQIATMDPRE-ITHTV--EILVPPRIHHISTGGHL 193
            .|..::     |.:.|||:.....|.|.|.||::|  |.. |:|.|  :::||...  |...|.|
  Fly   136 ERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST--PTGIISHFVNLQVVVPEAF--ILGSGEL 196

  Fly   194 QVKKGSSVRIECSATGNPMP--NVTWSRKNNIL----------------PNGEEKLHSHVLSIEN 240
            .|..||::.:.|....:|.|  .|.|.:.:.::                |..:.:     |.|..
  Fly   197 HVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSR-----LIIRE 256

  Fly   241 VDRHKGGVYICTANNRVGQPASSQV 265
            ......|.|.|:|:|.  :|||..|
  Fly   257 PQVTDSGNYTCSASNT--EPASIYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 29/94 (31%)
Ig 103..177 CDD:143165 27/88 (31%)
IG_like 191..269 CDD:214653 22/93 (24%)
IGc2 198..258 CDD:197706 15/77 (19%)
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
dpr12NP_652462.3 IG 86..183 CDD:214652 30/98 (31%)
Ig_3 193..271 CDD:404760 17/82 (21%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/8 (13%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.