DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr6

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:227 Identity:67/227 - (29%)
Similarity:95/227 - (41%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EPMF-ISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLVN--- 143
            ||.| .|.......:.|::..|.|.|.|.....|:|  .|.|.|||.||...|.|.|.:..:   
  Fly    72 EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136

  Fly   144 --GFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECS 206
              .:.|||:.|...|||.|.|||:|...|.....:.::||...  |..|..|.|.|||::.:.|:
  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTAT--ILGGPDLHVDKGSTINLTCT 199

  Fly   207 ATGNPMP--NVTWSRKNNILPNGEEK-----------LHSHVLSIENVDRHKGGVYICTANNRVG 258
            ...:|.|  .:.|.....::.....:           :.:..|.|:|.|....|.|.|..:|  .
  Fly   200 VKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN--A 262

  Fly   259 QPASSQVVLHVLFSPEISVERPVVFSGEGHEA 290
            ..||.:|  |||     :|.  .:.|||..||
  Fly   263 DVASVRV--HVL-----NVR--AIISGEHPEA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 30/86 (35%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 2/5 (40%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 22/99 (22%)
Ig strand B 201..205 CDD:409353 0/3 (0%)
Ig strand C 214..218 CDD:409353 0/3 (0%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 6/18 (33%)
FN3 <466..524 CDD:238020
dpr6NP_001287018.1 FR1 79..96 CDD:409355 2/16 (13%)
IG_like 80..175 CDD:214653 30/94 (32%)
Ig strand A' 83..85 CDD:409355 0/1 (0%)
Ig strand B 89..97 CDD:409355 2/7 (29%)
CDR1 97..104 CDD:409355 2/6 (33%)
FR2 105..114 CDD:409355 3/8 (38%)
Ig strand C 105..110 CDD:409355 2/4 (50%)
CDR2 115..129 CDD:409355 7/13 (54%)
Ig strand D 129..135 CDD:409355 0/5 (0%)
FR3 130..159 CDD:409355 9/28 (32%)
Ig strand E 139..145 CDD:409355 2/5 (40%)
Ig strand F 153..160 CDD:409355 4/6 (67%)
IG_like 184..271 CDD:214653 20/90 (22%)
Ig strand B 194..198 CDD:409353 0/3 (0%)
Ig strand C 209..213 CDD:409353 0/3 (0%)
Ig strand E 240..244 CDD:409353 1/3 (33%)
Ig strand F 254..259 CDD:409353 2/4 (50%)
Ig strand G 268..271 CDD:409353 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.