DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr6

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:227 Identity:67/227 - (29%)
Similarity:95/227 - (41%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EPMF-ISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLVN--- 143
            ||.| .|.......:.|::..|.|.|.|.....|:|  .|.|.|||.||...|.|.|.:..:   
  Fly    72 EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQD 136

  Fly   144 --GFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECS 206
              .:.|||:.|...|||.|.|||:|...|.....:.::||...  |..|..|.|.|||::.:.|:
  Fly   137 TEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTAT--ILGGPDLHVDKGSTINLTCT 199

  Fly   207 ATGNPMP--NVTWSRKNNILPNGEEK-----------LHSHVLSIENVDRHKGGVYICTANNRVG 258
            ...:|.|  .:.|.....::.....:           :.:..|.|:|.|....|.|.|..:|  .
  Fly   200 VKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN--A 262

  Fly   259 QPASSQVVLHVLFSPEISVERPVVFSGEGHEA 290
            ..||.:|  |||     :|.  .:.|||..||
  Fly   263 DVASVRV--HVL-----NVR--AIISGEHPEA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 30/86 (35%)
Ig 103..177 CDD:143165 29/80 (36%)
IG_like 191..269 CDD:214653 20/90 (22%)
IGc2 198..258 CDD:197706 14/72 (19%)
I-set 273..360 CDD:254352 6/18 (33%)
Ig 290..359 CDD:143165 1/1 (100%)
FN3 <466..524 CDD:238020
dpr6NP_001287018.1 V-set 79..174 CDD:284989 30/94 (32%)
IG_like 80..175 CDD:214653 30/94 (32%)
IG_like 184..271 CDD:214653 20/90 (22%)
IGc2 191..262 CDD:197706 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.