DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and NCAM1

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:674 Identity:140/674 - (20%)
Similarity:237/674 - (35%) Gaps:228/674 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWK---------------------- 120
            |.:|.||.|      ...:|..||..|:.|:|.::....:.||                      
Human   116 QKLMFKNAP------TPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYL 174

  Fly   121 --RGI------------AILTAGS---------VKVTP--DPRVRLVN----------------G 144
              |||            .||..|.         |.|.|  ..|..:||                |
Human   175 QIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEG 239

  Fly   145 F------------------------------NLQIRDALPTDAGDYICQIATMDPREITHTV--E 177
            |                              .|.|:.....|..:||| ||.....|...|:  :
Human   240 FPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYIC-IAENKAGEQDATIHLK 303

  Fly   178 ILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTW-SRKNNI------------------ 223
            :...|:|.::.....:::::  .|.:.|.|:|:|:|::|| :...||                  
Human   304 VFAKPKITYVENQTAMELEE--QVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQEVHA 366

  Fly   224 -----------------LPNGEEKLHSHV----------LSIENVDRHKGGVYICTANNRVGQPA 261
                             .|...|.|..|:          |:::::.....|.|||||:|.:||.:
Human   367 PWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDS 431

  Fly   262 SSQVVLHVLFSPEISVERPV-VFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTER---HIME 322
            .| :.|.|.::|::  :.|| |::.||::..:.|.|.......:.||:|...|.::..   .|..
Human   432 QS-MYLEVQYAPKL--QGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYN 493

  Fly   323 TRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQL----SGKPNVAVFNSPPISQ---YKDR 380
            |..:.: |.:......|||||:|.|.|::|  :::|:.    :..|     :||.|.|   |...
Human   494 TPSASY-LEVTPDSENDFGNYNCTAVNRIG--QESLEFILVQADTP-----SSPSIDQVEPYSST 550

  Fly   381 YNISW---AVDSHSPIEEYKLSFRKLPQGHEVVGNA-IDSSSSSSSMSSSSSQMYGSGLHAHRI- 440
            ..:.:   ......||.:||..:|.:  |.||..:. .|:..:|.....:...:.....:|.|: 
Human   551 AQVQFDEPEATGGVPILKYKAEWRAV--GEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLA 613

  Fly   441 ---GSNMGGLSGLSG---------------SGSYSGYGNVI---------------HW------G 466
               |..:|.:|..|.               .|.....||.|               |:      .
Human   614 ALNGKGLGEISAASEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRAL 678

  Fly   467 HNDWR-NVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGP 530
            .::|: .:.||:  .|.|      .|::.||.:..||..|.:.|:.|.|...: |||.||:....
Human   679 SSEWKPEIRLPS--GSDH------VMLKSLDWNAEYEVYVVAENQQGKSKAAH-FVFRTSAQPTA 734

  Fly   531 VDLSTFLNHGLSDNEMRDLSVTFY 554
            :..:.....|||...:..:.:..:
Human   735 IPANGSPTSGLSTGAIVGILIVIF 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 31/174 (18%)
Ig 103..177 CDD:143165 29/168 (17%)
IG_like 191..269 CDD:214653 26/123 (21%)
IGc2 198..258 CDD:197706 22/105 (21%)
I-set 273..360 CDD:254352 25/90 (28%)
Ig 290..359 CDD:143165 18/71 (25%)
FN3 <466..524 CDD:238020 17/58 (29%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 12/71 (17%)
Ig 211..307 CDD:325142 16/96 (17%)
Ig 306..438 CDD:325142 28/134 (21%)
Ig_3 447..519 CDD:316449 21/72 (29%)
FN3 534..631 CDD:238020 22/103 (21%)
fn3 639..720 CDD:306538 18/88 (20%)
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.