DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Dscam3

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:503 Identity:109/503 - (21%)
Similarity:186/503 - (36%) Gaps:125/503 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ESVSAQSMMTKNEPMFISRSETFKF----ITGETIVLPCEVANTDTYV-VAWKRGIAILTAGSVK 132
            |.......:..|.|..|   |.|||    ..|....:.|.|::.|..: .:||:..:.:.: |::
  Fly   620 EEARRDMQLNVNSPPVI---EPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPS-SLQ 680

  Fly   133 VTPDPRVRLVNGFNLQI-RDALPTDAGDYICQIATMDPREITHTVE--ILVPPRIHH--ISTGGH 192
            :|.    :....::|.: :|.....:|.|.| .|:....::.:|.|  :.|.||..:  :.|.  
  Fly   681 ITE----KKEEFYSLLVFKDISARHSGKYTC-YASNAAAKVNYTAELQVRVAPRWRYEPMDTA-- 738

  Fly   193 LQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEK---------LHSHVLSIENVDRHKGGV 248
              :..|:::.|.|.|.|.|:|.:||.:       |:.|         :.:|.|.:.....:..|.
  Fly   739 --IMLGNTISINCEAEGYPIPTITWFK-------GQGKGSKDFKPLSMRNHSLLLNLATDNDEGY 794

  Fly   249 YICTANNRVGQPASSQVVLHVLFSPEISVERPVVF--------SGEGHEATLVCIVHGETQPEVI 305
            |:|.|.|.:|......:        .|:|..|..|        |......||.|...|:....:.
  Fly   795 YMCQATNEIGAGLKKTI--------RINVNEPARFEQSARNISSRRNDPVTLDCHAKGDEPITIG 851

  Fly   306 WFKDTMQLDTTERHI----MET-RGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPN 365
            |.::..::|......    |:| :|....|.|......|.|.|.|:|||..|:|.:.:.|     
  Fly   852 WTQNNGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFL----- 911

  Fly   366 VAVFNSPPISQYKDRYNI-------SW--AVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSS 421
             ||...|....:.:.:.:       ||  ..|.:||:..|.:.::.|..                
  Fly   912 -AVQERPDTPSHLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKY---------------- 959

  Fly   422 SMSSSSSQMYGSGLHAHRIGSNMGGLSGLSGSGSYSGYGNVIHWGHNDWRNVVLPAVPVSHHYAQ 486
                         |.:|      |.|:...|..:    |:||        ||.||:..:|..|..
  Fly   960 -------------LQSH------GSLAAAGGDWN----GHVI--------NVSLPSTSISRSYDS 993

  Fly   487 GM--SYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGPVD 532
            .:  |.:|.||.|...:...:|:.|....|..|.:.|..| ..:.|.:
  Fly   994 DLRESAIVAGLTPATTFLIRMQAINEIERSAYTEAIVLKT-QEEAPTE 1040

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 16/83 (19%)
Ig 103..177 CDD:143165 14/75 (19%)
IG_like 191..269 CDD:214653 19/86 (22%)
IGc2 198..258 CDD:197706 18/68 (26%)
I-set 273..360 CDD:254352 25/99 (25%)
Ig 290..359 CDD:143165 20/73 (27%)
FN3 <466..524 CDD:238020 16/59 (27%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 21/98 (21%)
ig 645..712 CDD:278476 14/72 (19%)
IG_like 734..815 CDD:214653 21/99 (21%)
Ig 745..815 CDD:299845 19/84 (23%)
I-set 820..913 CDD:254352 23/98 (23%)
Ig 838..920 CDD:299845 23/87 (26%)
FN3 917..1033 CDD:238020 32/162 (20%)
FN3 1040..1142 CDD:238020 0/1 (0%)
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.