DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Dscam2

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:591 Identity:125/591 - (21%)
Similarity:209/591 - (35%) Gaps:177/591 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KQNSKTGKMAAEARTISKPGHIRDRRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRS 92
            ::||.:|.....||  :|.|| ..||.|.:..|:                        |..:|..
  Fly   580 QKNSDSGVYTCWAR--NKQGH-SARRSGEVTVIV------------------------PPKLSPF 617

  Fly    93 ET--FKFITGETIVLPCEVANTD-TYVVAWKRGIAILTAGSVKVTPDPRVRLVNGFN-LQIRDAL 153
            :|  .:...|:...|.|.|...| ...:.|::     ....:..|....|:.|:.:| :.:.:.|
  Fly   618 QTNILQLNMGDRASLTCSVVKGDLPLTINWRK-----DGRPIDPTQHMSVKQVDQYNSILVIENL 677

  Fly   154 PTD-AGDYICQIATMDPREITHTVEIL--VPPR--IHHISTGGHLQVKKGSSVRIECSATGNPMP 213
            .:| .|:|.| :......|:.::..:|  ||||  :..:..    .|::...:.:.|.|.|.|.|
  Fly   678 GSDHTGNYSC-VVRNSAAEVENSQALLVNVPPRWIVEPVDA----NVERNRHIMLHCQAQGVPTP 737

  Fly   214 NVTWSRK----------------NNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPAS 262
            ::.|.:.                ..:|.||.       |.:::|...:.|.|:|.|||.:|....
  Fly   738 SIVWKKATGSKSGEYEEVRERPFTKLLGNGS-------LLLQHVKEDREGFYLCQANNGIGTGIG 795

  Fly   263 SQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWF---KDTMQLDTTERHIMETR 324
            ..:.|.|..||..|.....|...:|..|.|.|.|.|:....::|.   |:|:...|..:..::..
  Fly   796 KVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQE 860

  Fly   325 ----GSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGK-----PNV---AVFNS------ 371
                |....|.||.|...|.|.|.|.|.|..|..::.:||..:     |:|   |:.:|      
  Fly   861 ATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIK 925

  Fly   372 -------------------------PP---ISQY-----KDRYNISWAVDSHSPIEEYKLSFRKL 403
                                     ||   :.|:     ||..:.:..:::..|...|  :||.:
  Fly   926 WQPKTLGTGDVTKYIVEFREADHSLPPALFVDQWQQIEVKDPPHFNAMIENLKPATRY--AFRVI 988

  Fly   404 PQGHEVVGNAIDSSS---------------SSSSMSSSSSQMYGSGL-------HAHRIGSNMGG 446
            .:|.  .|.:..|..               |.|:...||:::..|.:       |....|.|:|.
  Fly   989 AEGS--AGRSAPSQELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGY 1051

  Fly   447 LSGLSGSGSY-----SGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQ 506
            ....||:.:|     ||.|:    |.|.                   ..::.||.....|...||
  Fly  1052 KLSSSGNTAYNFTSVSGDGD----GGNG-------------------ELLLSGLAKFARYTVVVQ 1093

  Fly   507 SRNRYG 512
            :.|:.|
  Fly  1094 AFNQVG 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 17/84 (20%)
Ig 103..177 CDD:143165 15/76 (20%)
IG_like 191..269 CDD:214653 20/93 (22%)
IGc2 198..258 CDD:197706 17/75 (23%)
I-set 273..360 CDD:254352 25/93 (27%)
Ig 290..359 CDD:143165 21/75 (28%)
FN3 <466..524 CDD:238020 9/47 (19%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352 11/32 (34%)
IGc2 533..597 CDD:197706 6/18 (33%)
Ig 630..699 CDD:143165 15/74 (20%)
IG_like 714..802 CDD:214653 20/98 (20%)
Ig 725..802 CDD:299845 19/83 (23%)
Ig 823..894 CDD:143165 21/70 (30%)
FN3 906..1006 CDD:238020 16/103 (16%)
FN3 1013..1111 CDD:238020 24/110 (22%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.