DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and CG13506

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:531 Identity:113/531 - (21%)
Similarity:208/531 - (39%) Gaps:119/531 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 MTKNE------PMFISRSETFKFITGETIVLPCEVANTD-TYVVAWKRGIAILTAGSVKVTPDPR 138
            :|||.      |.|.......:...|:.::|.|:..|.. :..|.|.:...|:..|...::  .|
  Fly    59 VTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPIS--QR 121

  Fly   139 VRLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQV-------- 195
            |:.:...::.:|:..|.|:.||.|:|.....|:  ||.          :..|..|.:        
  Fly   122 VQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQ--HTA----------LRVGARLSILCDDRDIT 174

  Fly   196 ------KKGSSVRIECSATGNPMPNVTWSRKN-NILPNGEEKLHSHVLSIENVDRHKGGVYICTA 253
                  ::|...::||.........:.||..: |..|:..:. .:.|:.::|||....|.|.|.|
  Fly   175 DRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDN-QNGVIILDNVDEKNAGDYQCLA 238

  Fly   254 NNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTER 318
            ::....|....|.:.|.:||.:|..|..|.:.:|..|.|.|....:......:.||...|..:::
  Fly   239 DDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDK 303

  Fly   319 HIME----TRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKD 379
            :.::    ...:|.|||:|:|...|.|.|.|..||.:|        |.:..|.|..:|...|::|
  Fly   304 YSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIG--------SNEVKVHVSYNPETPQFED 360

  Fly   380 RYNISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNM 444
                       ..:|..|::...|.:.|:::..|:.....:.|.:.|:.|:    |..||     
  Fly   361 -----------MTVEGNKVTLHWLVRSHQLLSEAMLDYQLTGSYTWSTVQV----LETHR----- 405

  Fly   445 GGLSGLSGSGSYSGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRN 509
                                  ||:..|:    ..::|...     :.||:     :.|.|:::|
  Fly   406 ----------------------HNNTDNI----WKITHQLE-----LSRGV-----WHARVKTKN 434

  Fly   510 RYGWSDLTNSFVF-----STSSNDGPVDL--STFLNHGLSDNEMRDLSVTFYGSSAINRQKLGLL 567
            ..|||..:|..||     |....|..|:|  ...:..|:       :.::...:|::.|..:|::
  Fly   435 TKGWSHFSNDHVFEIPEDSEVDKDEEVELPPDEIVQAGI-------MPMSKGAASSMQRLNVGVI 492

  Fly   568 ALSSATLALSL 578
            .|::..|.:.|
  Fly   493 LLAALLLRVRL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/80 (25%)
Ig 103..177 CDD:143165 19/74 (26%)
IG_like 191..269 CDD:214653 18/92 (20%)
IGc2 198..258 CDD:197706 15/60 (25%)
I-set 273..360 CDD:254352 24/90 (27%)
Ig 290..359 CDD:143165 19/72 (26%)
FN3 <466..524 CDD:238020 15/62 (24%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/68 (22%)
IGc2 83..146 CDD:197706 15/64 (23%)
IG_like 176..254 CDD:214653 17/78 (22%)
Ig 176..239 CDD:299845 14/63 (22%)
I-set 258..349 CDD:254352 26/98 (27%)
Ig 275..348 CDD:143165 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.