DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and wrapper

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:486 Identity:131/486 - (26%)
Similarity:213/486 - (43%) Gaps:89/486 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR-GIAILTAGSVKVTPDPRVRLVNGFN 146
            :|...|.|...|.|....:|:.|||.: ||....|.|.| .:|::.:...::.|..|:.|....:
  Fly    32 ENSQKFKSIPTTVKTYENDTVQLPCTL-NTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGS 95

  Fly   147 LQIRDALPTDAGDYICQIATMDPREIT--HTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATG 209
            ||:.:...:|.|||.|:: ..|...:.  |.:|:.:.|:: .|......:.:.|:...:.|.|.|
  Fly    96 LQVANVQSSDTGDYYCEM-NSDSGHVVQQHAIEVQLAPQV-LIEPSDLTEQRIGAIFEVVCEAQG 158

  Fly   210 NPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPE 274
            .|.|.:||....|::.......:...|.:|...|::.|:..|.|:|.||:||.:.|.||||||||
  Fly   159 VPQPVITWRLNGNVIQPQSNTGNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPE 223

  Fly   275 ISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQL-----DTTERHIMETRGS-------- 326
            :|:.:|||::..|..|.|.|||.......|.||...:.:     .||....::|..|        
  Fly   224 VSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAV 288

  Fly   327 RHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHS 391
            ||.|:::.|...|.|.|.|.|.||:.....:::|:|:|...:|...|.:|....:.:.|..:|..
  Fly   289 RHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKINPGTQSSTSHVLVWQTESLL 353

  Fly   392 PIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSGLSGSGSY 456
            ||.|:||.||::|                                     ||             
  Fly   354 PIMEFKLKFRQIP-------------------------------------SN------------- 368

  Fly   457 SGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGM----SYMVRGLDPDQHYEATVQSRNRYGWSDLT 517
                ||......:|..:.:||     ....|:    :|.:.||.|...||.:|.:||.:||||.:
  Fly   369 ----NVTRQVRTNWTELTIPA-----QATNGLIYITTYTLHGLQPASLYEVSVLARNSFGWSDNS 424

  Fly   518 NSFVFSTSSNDGPVDLSTFLNHGLSDNEMRD 548
            ....|:|.   |.|:|..:    .:::|::|
  Fly   425 KIVRFATG---GEVELPNY----STESELQD 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 23/82 (28%)
Ig 103..177 CDD:143165 21/76 (28%)
IG_like 191..269 CDD:214653 22/77 (29%)
IGc2 198..258 CDD:197706 16/59 (27%)
I-set 273..360 CDD:254352 30/99 (30%)
Ig 290..359 CDD:143165 23/81 (28%)
FN3 <466..524 CDD:238020 18/61 (30%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 23/84 (27%)
IG_like 41..118 CDD:214653 23/78 (29%)
IG_like 145..218 CDD:214653 22/72 (31%)
Ig 147..219 CDD:299845 23/71 (32%)
I-set 224..323 CDD:254352 28/98 (29%)
IGc2 236..314 CDD:197706 24/77 (31%)
FN3 339..431 CDD:238020 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4772
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D332048at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.