DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Sdk2

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:515 Identity:123/515 - (23%)
Similarity:201/515 - (39%) Gaps:88/515 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PMFISRSETFKFITGE---TIVLPCEVANTDTYVVAWKRGIAILTAGSVKVTPDPRVRLVNGFNL 147
            |.|:...|  :.||.|   .:.:||.........:.|.:..|::..|  |:|   |.:..:...|
  Rat   311 PQFVREPE--RHITAEMEKVVDIPCRAKGVPPPSITWYKDAALVEVG--KLT---RFKQRSDGGL 368

  Fly   148 QIRDALPTDAGDYIC--QIATMDPREITHTVEILVPPRIHHISTGGHLQ--VKKGSSVRIECSAT 208
            ||...||.|.|...|  ..|..:.:..|:.....:.|.|    |.|.|.  |..|.||.:.|..:
  Rat   369 QISGLLPDDTGMVQCFAHNAAGEAQTSTYLAVTSIAPNI----TRGPLDSTVIDGMSVVLACETS 429

  Fly   209 GNPMPNVTWSRKNNILPNGEEK------LHSHVLSIENVDRHKGGVYICTANNRVG-QPASSQVV 266
            |.|.|.:||.:...||.:|..:      |.|..|.|........|.|.|.|.|..| ..||:.:|
  Rat   430 GAPRPAITWQKGERILASGSVQLPRFTLLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLV 494

  Fly   267 L----HVLFSPEISVERPVVFSGEGHEATLVC-IVHGETQPEV----IWFKD--TMQLDTTERHI 320
            :    .:...|:   ::.|:   :|.:|::|| :.|   .|.|    :|.||  |:.::|..|..
  Rat   495 VWARTRITKPPQ---DQSVI---KGTQASMVCGVTH---DPRVTVRYVWEKDGATLAVETNPRIR 550

  Fly   321 METRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKT--LQLSGKPNVAVFNSPPISQYKDR-YN 382
            ::..||.|   |.:....|.|.|:|...:..|...:.  |::...|:........:|..:.| .|
  Rat   551 LDRNGSLH---ISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVRQLPHAPEHPVATLSTMERRAIN 612

  Fly   383 ISWA--VDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMG 445
            ::||  .|.:||:..|.|         |:..|....:...:|:...::.:...||...|  |...
  Rat   613 LTWAKPFDGNSPLMRYIL---------EMSENNAPWTILLASVDPEATSVMVKGLVPAR--SYQF 666

  Fly   446 GLSGLS--GSGSYSGYGNVIHWGHNDWRNVVL----PAVPVSHHYAQG---MSYMVRGLDPDQHY 501
            .|..::  |.|.:|          .|...|.|    |..|..:..|.|   .|.|::...|.:.:
  Rat   667 RLCAVNDVGKGQFS----------KDTERVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESH 721

  Fly   502 EATVQSRN--RYGWSDLTNSFVFSTSSNDGPVDLSTFLNHGLSDNEMRDLSVTFYGSSAI 559
            :..:....  ||..:.|...:.|   .|....|::..|...|......::.|..|.|:.:
  Rat   722 QNGILKGYIIRYCLAGLPVGYQF---KNITDADVNNLLLEDLIIWTNYEIEVAAYNSAGL 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 19/84 (23%)
Ig 103..177 CDD:143165 18/75 (24%)
IG_like 191..269 CDD:214653 28/90 (31%)
IGc2 198..258 CDD:197706 21/65 (32%)
I-set 273..360 CDD:254352 25/95 (26%)
Ig 290..359 CDD:143165 21/77 (27%)
FN3 <466..524 CDD:238020 14/66 (21%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653
Ig 135..191 CDD:299845
IG_like 225..307 CDD:214653
IGc2 236..289 CDD:197706
I-set 311..400 CDD:254352 24/95 (25%)
Ig 329..397 CDD:143165 17/72 (24%)
I-set 405..495 CDD:254352 30/93 (32%)
Ig 419..495 CDD:299845 24/75 (32%)
Ig 505..589 CDD:299845 25/95 (26%)
IG_like 505..589 CDD:214653 25/95 (26%)
FN3 593..684 CDD:238020 23/111 (21%)
FN3 696..789 CDD:238020 17/86 (20%)
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.