DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Dscam1

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:404 Identity:98/404 - (24%)
Similarity:157/404 - (38%) Gaps:90/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GETIVLPCEVANTDTYV-VAWKRGIAILTAGSVKVTPDPRVRLVNGFN--LQIRDALPTDAGDYI 161
            |::|.|.|::...|..: |.|....:....|..:|.|..|...::...  :.|..|.|...|...
  Fly   636 GDSIDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDT 700

  Fly   162 CQIATMDPREITHTVEIL--VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNIL 224
            | ||:......|::|::.  ||||  .|.........:||..::||.|.|.|.|.|||.:.....
  Fly   701 C-IASNKAGTTTYSVDLTVNVPPR--WILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDT 762

  Fly   225 PNGEEK---------LHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERP 280
            | ||.|         :....|.::|:.:...|.|:|.|.|.:|...|:.:::.|...||.:.:..
  Fly   763 P-GEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLR 826

  Fly   281 VVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLD-------TTERHIMETRGSRHTLIIRKVHPQ 338
            ...:..|..|.|.|...||....::|..:.|:||       |....|:.| |...:|.|::....
  Fly   827 NQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILST-GVMSSLSIKRTERS 890

  Fly   339 DFGNYSCVAENQLGK-----------------ARKTLQLSGKPNVAVFNSPPISQYKDRYNISWA 386
            |...::|||.|..|.                 |.|.|..||:                ...:|||
  Fly   891 DSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGR----------------SVQLSWA 939

  Fly   387 --VDSHSPIEEYKLSFRK-----------LPQGHE------------------VVGNAIDSSSSS 420
              .|.:||::.|.:.|::           :..||.                  |..|||.:|.||
  Fly   940 QPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSS 1004

  Fly   421 SSMSSSSSQMYGSG 434
            .:::..:::...||
  Fly  1005 EAVTIITAEEAPSG 1018

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 20/84 (24%)
Ig 103..177 CDD:143165 18/76 (24%)
IG_like 191..269 CDD:214653 24/86 (28%)
IGc2 198..258 CDD:197706 22/68 (32%)
I-set 273..360 CDD:254352 27/110 (25%)
Ig 290..359 CDD:143165 23/92 (25%)
FN3 <466..524 CDD:238020
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165 17/73 (23%)
IGc2 735..804 CDD:197706 22/69 (32%)
I-set 819..914 CDD:254352 24/95 (25%)
Ig 833..921 CDD:299845 22/88 (25%)
FN3 918..1011 CDD:238020 22/108 (20%)
FN3 1018..1116 CDD:238020 1/1 (100%)
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.