DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and dpr19

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:299 Identity:66/299 - (22%)
Similarity:115/299 - (38%) Gaps:60/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 HFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKV 133
            ||.:.......|||....|::.       |...:|||.|.......|:|  ::...:||.|....
  Fly    33 HFGNTLQSQFNTKNNTRVIAQK-------GGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTH 90

  Fly   134 TPDPR-----VRLVNGFNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHL 193
            :.|.|     .|.:..::|:|:.....|.|.|.||::....:.|  .:|:.:...:..||:...|
  Fly    91 SSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSI--VIELKIVEAVAEISSAPEL 153

  Fly   194 QVKKGSSVRIECS---ATGNPMPNVTWSRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTANN 255
            .:.:.|::|:||.   ||.|| ..|.|...:.:: |.:.:....|.||...:...|..|..:..|
  Fly   154 HIDETSTLRLECKLKRATENP-AFVFWYHDSKMI-NYDSQGGFVVTSIGQSNPQSGQFYRSSPAN 216

  Fly   256 --RVGQP-ASSQVVLHVLFSPEISVERPVV-------FSGEGHEATLVCIVHGETQPEVIWFKDT 310
              |...| .||..||:.|.....:::.|..       :..:.|::..:      ..|.|      
  Fly   217 KSRATMPMESSNGVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYL------LNPSV------ 269

  Fly   311 MQLDTTERHIMETRGSRHTLIIRKVHPQDFGNYSCVAEN 349
                             ..|.:::|:.:..|||:|...|
  Fly   270 -----------------SVLTVKQVNFRHAGNYTCAPSN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 22/86 (26%)
Ig 103..177 CDD:143165 20/80 (25%)
IG_like 191..269 CDD:214653 24/83 (29%)
IGc2 198..258 CDD:197706 18/64 (28%)
I-set 273..360 CDD:254352 11/84 (13%)
Ig 290..359 CDD:143165 9/60 (15%)
FN3 <466..524 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 21/83 (25%)
IGc2 55..125 CDD:197706 18/69 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.