DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and DIP-eta

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:395 Identity:111/395 - (28%)
Similarity:182/395 - (46%) Gaps:54/395 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR--GIAILTAGSVKVTPDPRVRLVNG--- 144
            :|.|.|.........|....|.|.|.:...|.|||.|  ...|||..:..:|.:.|:.:.|.   
  Fly    42 DPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHK 106

  Fly   145 -FNLQIRDALPTDAGDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSAT 208
             :.::|:|...:|.|.|:|||.|...:.....::::|||.|....|...:.|::||:|.::|:||
  Fly   107 TWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAAT 171

  Fly   209 GNPMPNVTWSRKNNI---LPNGEEKLHSHVLSIE-------NVDRHKGGVYICTANNRVGQPASS 263
            |:|.|.:||.|::.:   |..|||     |:|||       ||.||..|.|:|.|:|.|....|.
  Fly   172 GSPEPTITWRRESGVPIELATGEE-----VMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSK 231

  Fly   264 QVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVI--WFKDTMQL----DTTERHIME 322
            ::.|.|.|.|.|:|:..::.:.||...||.|  ..|..|:.|  |.::..::    .....::.|
  Fly   232 RITLVVHFPPMITVQNQLIGAVEGKGVTLDC--ESEAYPKSINYWTRERGEIVPPGGKYSANVTE 294

  Fly   323 TRGSRHT--LIIRKVHPQDFGNYSCVAENQLGKARKTLQLSGKPNVAVFNSPP-----ISQYKDR 380
            ..|.|::  |.|..:...:||:|.|||:|.||....|::|        :..||     :..::.|
  Fly   295 IGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL--------YRIPPNAVNYVENFEAR 351

  Fly   381 Y---NISWAVDSHSPIEEYKLSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGS 442
            :   ..:.:.:||.|.       |......|.:.|.....:..|..:.|...:||:.....|...
  Fly   352 HKGKKRTKSSESHHPA-------RAQEHSGEDMENPGKRKADLSLGAESIDSIYGNSAAGSRRRQ 409

  Fly   443 NMGGL 447
            ::||:
  Fly   410 DLGGV 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/85 (28%)
Ig strand B 103..107 CDD:409353 1/3 (33%)
Ig strand C 116..120 CDD:409353 2/3 (67%)
Ig strand E 145..149 CDD:409353 0/3 (0%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 0/2 (0%)
Ig 182..269 CDD:472250 36/96 (38%)
Ig strand B 201..205 CDD:409353 1/3 (33%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 23/83 (28%)
FN3 <466..524 CDD:238020
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 24/85 (28%)
Ig strand B 60..64 CDD:409353 1/3 (33%)
Ig strand C 73..77 CDD:409353 2/3 (67%)
Ig strand E 108..112 CDD:409353 0/3 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
IgI_1_MuSK 145..237 CDD:409562 36/96 (38%)
Ig strand A 145..148 CDD:409562 1/2 (50%)
Ig strand A' 153..158 CDD:409562 0/4 (0%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 2/4 (50%)
Ig strand C' 184..186 CDD:409562 0/1 (0%)
Ig strand D 194..197 CDD:409562 2/7 (29%)
Ig strand E 202..208 CDD:409562 0/5 (0%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 2/7 (29%)
IG_like 252..335 CDD:214653 25/92 (27%)
Ig strand B 258..262 CDD:409353 2/3 (67%)
Ig strand C 271..282 CDD:409353 2/10 (20%)
Ig strand E 301..306 CDD:409353 1/4 (25%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.