DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and fipi

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:562 Identity:113/562 - (20%)
Similarity:188/562 - (33%) Gaps:166/562 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RRVGSLPHILFLAIAVVSLHFESVSAQSMMTKNEPMFISRSE-TFKFITGETIVLPCEVANTDTY 115
            |.:|.:.::..|.....:.|.||:|            :|.:| :....|.|::::.|.       
  Fly     2 RLIGFILNLAALTAVAWANHHESLS------------LSPAEHSVVRYTNESLIVQCR------- 47

  Fly   116 VVAWKRGIAILTAGSVKVTPDPRVRL-----------------------VNGFNLQIRDALPTDA 157
                              :|||:|.|                       .....:........|.
  Fly    48 ------------------SPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADK 94

  Fly   158 GDYICQIATMDPREITHTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTW----- 217
            |::.|:.|  |....:.:.:::|..:|........:.||:|....|.|...|.|.|||||     
  Fly    95 GNWSCEAA--DGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQ 157

  Fly   218 --------SRKNNILPNGEEKLHSHVLSIENVDRHKGGVYICTAN--NRVGQPASSQVVLHVLFS 272
                    ..|..||.:|        |.|..|.::..|.|.|.|.  |.:......:.||..:..
  Fly   158 PISAGAADDSKFRILADG--------LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEH 214

  Fly   273 PEISVERPVV---FSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTER-HIMETRGSRHTLIIR 333
            ..|..:.|.|   ::.....|||:|....|......|::...:|.:..| :.:::.....:|.|.
  Fly   215 KPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIH 279

  Fly   334 KVHPQDFGNYSCVAENQLGKARKTLQL-SGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYK 397
            .::...|.||.|.|.|.||...:|.:| .|:       .||                 ||.....
  Fly   280 VLNTSAFDNYRCRARNDLGTIERTTRLEQGE-------KPP-----------------SPANFQL 320

  Fly   398 LSFRKLPQGHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLSGLSGSGSYSGYGNV 462
            ..|.         .|..|...|:......|..    |::..|| ..|..:...:.:|.       
  Fly   321 RGFN---------SNTFDVVLSAPRGPPDSPM----GVNGFRI-EYMTEMEFKTDAGK------- 364

  Fly   463 IHWGHNDWRNVVLPAVPVSHHYAQGMSYMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSN 527
                   |.|    |....:.:.:|.::::..|:||..|.....|||..|:||.|....:.|.| 
  Fly   365 -------WTN----ARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKTLS- 417

  Fly   528 DGPVDLSTFLNHGLSDNEMRDLSVTFYGSSAINRQKLGLLAL 569
                 |...::.|:  .|.|::.|           :||::.|
  Fly   418 -----LEPRVSSGV--KETRNMCV-----------ELGVMTL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 12/102 (12%)
Ig 103..177 CDD:143165 11/96 (11%)
IG_like 191..269 CDD:214653 26/92 (28%)
IGc2 198..258 CDD:197706 22/74 (30%)
I-set 273..360 CDD:254352 22/90 (24%)
Ig 290..359 CDD:143165 19/69 (28%)
FN3 <466..524 CDD:238020 15/57 (26%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/108 (12%)
I-set 128..202 CDD:254352 24/81 (30%)
Ig 133..>193 CDD:299845 20/67 (30%)
IG_like 228..307 CDD:214653 19/78 (24%)
Ig 235..305 CDD:143165 19/69 (28%)
FN3 312..415 CDD:238020 29/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.