DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and DIP-beta

DIOPT Version :10

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:392 Identity:101/392 - (25%)
Similarity:161/392 - (41%) Gaps:91/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTY-----------VVAWKR 121
            ||....||.|      .||.|:...|......|......|.|.|...:           .|||.:
  Fly    86 VSNKISSVGA------FEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK 144

  Fly   122 --GIAILTAGSVKVTPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATMDPREI-THTVEIL 179
              ..|||......:|.:.|:.:    .|.:.|.||.....|||.|:||:.| ||.:: |.|:|::
  Fly   145 ADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT-DPMKMQTATLEVV 208

  Fly   180 VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN---ILPNGE------EKLHSHV 235
            :||.|.:..|.|.:.|.:|.|.::.|.|.|:|.|.:||.|::.   |..||.      :.:...:
  Fly   209 IPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEM 273

  Fly   236 LSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGET 300
            |::..:.|.:.|.|:|.|:|.|....|.::.|.|.|.|.:.|...:|.:....:.||:|.|  |.
  Fly   274 LTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNV--EA 336

  Fly   301 QPEVI--WFKDTMQLDTTERHIMETRGSRHTLI--------------IRKVHPQDFGNYSCVAEN 349
            .|:.|  |.::..:        |...|.|:.|.              |:::...|||.|.|:::|
  Fly   337 SPKAINYWQRENGE--------MIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKN 393

  Fly   350 QLGKARKTLQL--SGKPNVAVFNSPPISQ------------------------YKDRYNISWAVD 388
            .:|....|::|  ..:|...:.....:::                        ||||     |.|
  Fly   394 SIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDR-----APD 453

  Fly   389 SH 390
            .|
  Fly   454 QH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/97 (29%)
Ig strand B 103..107 CDD:409353 0/3 (0%)
Ig strand C 116..120 CDD:409353 2/3 (67%)
Ig strand E 145..149 CDD:409353 1/3 (33%)
Ig strand F 159..164 CDD:409353 2/4 (50%)
Ig strand G 173..176 CDD:409353 1/2 (50%)
Ig 182..269 CDD:472250 28/95 (29%)
Ig strand B 201..205 CDD:409353 0/3 (0%)
Ig strand C 214..218 CDD:409353 1/3 (33%)
Ig strand F 248..253 CDD:409353 2/4 (50%)
Ig strand G 262..265 CDD:409353 1/2 (50%)
Ig_3 273..349 CDD:464046 21/91 (23%)
FN3 <466..524 CDD:238020
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 31/111 (28%)
Ig strand B 115..119 CDD:409353 0/3 (0%)
Ig strand C 139..143 CDD:409353 2/3 (67%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 28/95 (29%)
Ig strand B 230..234 CDD:409353 0/3 (0%)
Ig strand C 243..247 CDD:409353 1/3 (33%)
Ig strand E 272..276 CDD:409353 1/3 (33%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 21/87 (24%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 2/4 (50%)
Ig strand E 365..376 CDD:409353 0/10 (0%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.