DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:392 Identity:101/392 - (25%)
Similarity:161/392 - (41%) Gaps:91/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VSLHFESVSAQSMMTKNEPMFISRSETFKFITGETIVLPCEVANTDTY-----------VVAWKR 121
            ||....||.|      .||.|:...|......|......|.|.|...:           .|||.:
  Fly    86 VSNKISSVGA------FEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIK 144

  Fly   122 --GIAILTAGSVKVTPDPRVRL----VNGFNLQIRDALPTDAGDYICQIATMDPREI-THTVEIL 179
              ..|||......:|.:.|:.:    .|.:.|.||.....|||.|:||:.| ||.:: |.|:|::
  Fly   145 ADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNT-DPMKMQTATLEVV 208

  Fly   180 VPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNN---ILPNGE------EKLHSHV 235
            :||.|.:..|.|.:.|.:|.|.::.|.|.|:|.|.:||.|::.   |..||.      :.:...:
  Fly   209 IPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEM 273

  Fly   236 LSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGET 300
            |::..:.|.:.|.|:|.|:|.|....|.::.|.|.|.|.:.|...:|.:....:.||:|.|  |.
  Fly   274 LTLSKITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNV--EA 336

  Fly   301 QPEVI--WFKDTMQLDTTERHIMETRGSRHTLI--------------IRKVHPQDFGNYSCVAEN 349
            .|:.|  |.::..:        |...|.|:.|.              |:::...|||.|.|:::|
  Fly   337 SPKAINYWQRENGE--------MIIAGDRYALTEKENNMYAIEMILHIKRLQSSDFGGYKCISKN 393

  Fly   350 QLGKARKTLQL--SGKPNVAVFNSPPISQ------------------------YKDRYNISWAVD 388
            .:|....|::|  ..:|...:.....:::                        ||||     |.|
  Fly   394 SIGDTEGTIRLYEMERPGKKILRDDDLNEVSKNEVVQKDTRSEDGSRNLNGRLYKDR-----APD 453

  Fly   389 SH 390
            .|
  Fly   454 QH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 28/97 (29%)
Ig 103..177 CDD:143165 26/91 (29%)
IG_like 191..269 CDD:214653 25/86 (29%)
IGc2 198..258 CDD:197706 20/68 (29%)
I-set 273..360 CDD:254352 24/102 (24%)
Ig 290..359 CDD:143165 21/84 (25%)
FN3 <466..524 CDD:238020
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 31/111 (28%)
ig 102..195 CDD:278476 23/92 (25%)
IG_like 219..307 CDD:214653 25/87 (29%)
Ig 221..307 CDD:299845 24/85 (28%)
Ig 311..404 CDD:299845 24/102 (24%)
IG_like 327..405 CDD:214653 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.