DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34353 and Opcml

DIOPT Version :9

Sequence 1:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:312 Identity:98/312 - (31%)
Similarity:149/312 - (47%) Gaps:19/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LFL---AIAVVSLHFESVSAQSMMTKN-EPMFISRSETFKFITGETIVLPCEVANTDTYVVAWKR 121
            |||   .:.||||....:....:..:: :..|....:......||:..|.|.:.:..|. |||..
Mouse     7 LFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTR-VAWLN 70

  Fly   122 GIAILTAGSVKVTPDPRV-RLVN---GFNLQIRDALPTDAGDYICQIATMDPREITHTVEIL--V 180
            ...||.||:.|.:.|||| .|||   .:::.|::....|.|.|.|.:.| |....|..|.::  |
Mouse    71 RSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQT-DNHPKTSRVHLIVQV 134

  Fly   181 PPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSRKNNILPNGEEKL-HSHVLSIENVDRH 244
            ||:|.:||:  .:.|.:||||.:.|.|.|.|.|.|||  ::..:..|:..: ....|.|.::.|.
Mouse   135 PPQIMNISS--DITVNEGSSVTLLCLAIGRPEPTVTW--RHLSVKEGQGFVSEDEYLEISDIKRD 195

  Fly   245 KGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKD 309
            :.|.|.|:|.|.|..|...:|.:.|.:.|.||..:....| .|.:..|.|........|..|||:
Mouse   196 QSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVS-VGQKGILSCEASAVPMAEFQWFKE 259

  Fly   310 TMQLDTTERHI-METRGSRHTLIIRKVHPQDFGNYSCVAENQLGKARKTLQL 360
            ..:|.|....: :|.:|...||....|..:|:|||:|||.|:||....::.|
Mouse   260 DTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 29/85 (34%)
Ig 103..177 CDD:143165 26/77 (34%)
IG_like 191..269 CDD:214653 25/78 (32%)
IGc2 198..258 CDD:197706 21/60 (35%)
I-set 273..360 CDD:254352 28/87 (32%)
Ig 290..359 CDD:143165 23/69 (33%)
FN3 <466..524 CDD:238020
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 29/89 (33%)
Ig strand A' 44..49 CDD:409353 0/4 (0%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 4/6 (67%)
Ig strand C 64..70 CDD:409353 4/6 (67%)
CDR2 71..83 CDD:409353 5/11 (45%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 12/33 (36%)
Ig strand D 87..94 CDD:409353 4/6 (67%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/4 (50%)
Ig strand G 123..132 CDD:409353 2/8 (25%)
FR4 125..132 CDD:409353 2/6 (33%)
Ig_3 135..206 CDD:404760 26/74 (35%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand C 165..170 CDD:409353 4/6 (67%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 25/77 (32%)
putative Ig strand A 224..230 CDD:409353 3/5 (60%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.